Property Summary

NCBI Gene PubMed Count 243
PubMed Score 2436.99
PubTator Score 1690.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.05357051443635E-20
non-small cell lung cancer 2798 3.13224087382357E-5
nasopharyngeal carcinoma 1056 3.50476112270027E-5
pilocytic astrocytoma 3086 5.94391248405309E-5
Breast cancer 3099 7.82220841027226E-5
Pick disease 1893 1.02531848665004E-4
medulloblastoma, large-cell 6234 2.39307916109356E-4
atypical teratoid/rhabdoid tumor 1095 0.0010054849310776
psoriasis 6685 0.00102541306003106
non diabetic and post-ischemic heart failure 200 0.00243957815070543
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00261545577803415
ovarian cancer 8492 0.0032523628752382
ductal carcinoma in situ 1745 0.00626050357270081
Waldenstrons macroglobulinemia 765 0.00720589489642639
progressive supranuclear palsy 674 0.00860363574804613
Multiple myeloma 1328 0.00979830817411405
invasive ductal carcinoma 2950 0.0111838707153306
ulcerative colitis 2087 0.0135577065928488
gastric carcinoma 832 0.0162988229359033
type II diabetes mellitus and post-ischemic heart failure 89 0.0213824496472962
acute quadriplegic myopathy 1157 0.0250337286586748
Alzheimer's disease 644 0.0289393978246996
esophageal adenocarcinoma 737 0.0312896847529202
Duchenne muscular dystrophy 602 0.0443735664085902
astrocytic glioma 2241 0.046784899461981
Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0
pancreatic cancer 2300 0.0 2.0
Disease Target Count
Immunodeficiency 46 1

Expression

Synonym

Accession P02786 D3DXB0 Q1HE24 Q59G55 Q9UCN0 Q9UCU5 Q9UDF9 Q9UK21 TR
Symbols T9
TR
TFR
p90
CD71
TFR1
TRFR
IMD46

Gene

PANTHER Protein Class (1)

PDB

1SUV   3S9L   3S9M   3S9N   1CX8   1DE4   2NSU   3KAS  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (176)

PMID Text
26869514 Together, our findings reveal that TfR1 can contribute to the mitochondrial respiration and ROS production, which have essential roles in growth and survival of pancreatic cancer.
26642240 The importance of TfR1 in adaptive immunity.A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 These results demonstrate that in cells expressing the hTfR, Tacaribe virus internalization depends on the presence of cholesterol, dynamin and acidic intracellular vesicles.
26441243 The requirement for a threshold level of TFR1 expression can explain why among primary human hematopoietic cells, only erythroblasts efficiently take up H-ferritin.
26394034 Data indicate only the glycoproteins CD34+/CD71low population showed statistically significant differences between Diamond-Blackfan Anaemia (DBA) patients and controls.
26392563 Data show that transferrin (Tf) was attached to nanoparticles with an acid-cleavable linkage that facilities release of nanoparticles from Tf that are bound to Tf receptors (TfR) during transcytosis, promoting entry of the nanoparticles into the brain.
26339443 Case Report: cellular iron deficit due to the low level of transferrin receptor, particularly in erythroid tissue.
26232328 This study provides insights into the effector functions of human IgG3 in the context of an antibody targeting TfR1.
26214738 elucidation of a signalling pathway whereby C18:0 stearoylates TFR1, thereby inhibiting its activation of JNK signaling; this leads to reduced ubiquitination of mitofusin via HUWE1, thereby promoting mitochondrial fusion and function
26079381 Data show that interleukin 6 (IL-6) secretion and the percentage of CD71 antigen-positive T lymphocytes both uniquely predicted survival independent of papillomavirus infection status.
More...

AA Sequence

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT      1 - 70
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF     71 - 140
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV    141 - 210
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL    211 - 280
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME    281 - 350
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG    351 - 420
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG    421 - 490
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED    491 - 560
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA    561 - 630
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV    631 - 700
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF              701 - 760
//

Text Mined References (253)

PMID Year Title
26869514 2016 Transferrin receptor regulates pancreatic cancer growth by modulating mitochondrial respiration and ROS generation.
26642240 2016 A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 2016 Human transferrin receptor triggers an alternative Tacaribe virus internalization pathway.
26441243 2015 H-Ferritin Is Preferentially Incorporated by Human Erythroid Cells through Transferrin Receptor 1 in a Threshold-Dependent Manner.
26394034 2015 Immunophenotypic Profiling of Erythroid Progenitor-Derived Extracellular Vesicles in Diamond-Blackfan Anaemia: A New Diagnostic Strategy.
26392563 2015 Increased brain uptake of targeted nanoparticles by adding an acid-cleavable linkage between transferrin and the nanoparticle core.
26339443 2015 An unusual case of iron deficiency anemia is associated with extremely low level of transferrin receptor.
26232328 2015 Insights into the effector functions of human IgG3 in the context of an antibody targeting transferrin receptor 1.
26214738 2015 Regulation of mitochondrial morphology and function by stearoylation of TFR1.
26079381 2015 In Vitro-Stimulated IL-6 Monocyte Secretion and In Vivo Peripheral Blood T Lymphocyte Activation Uniquely Predicted 15-Year Survival in Patients with Head and Neck Squamous Cell Carcinoma.
More...