Property Summary

NCBI Gene PubMed Count 243
Grant Count 776
R01 Count 445
Funding $85,342,842.07
PubMed Score 2436.99
PubTator Score 1690.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (60)

Disease Z-score Confidence
Anemia 252 6.337 3.2
Hemochromatosis 55 5.983 3.0
Nutritional deficiency disease 9 5.507 2.8
Cancer 2,346 5.06 2.5
Thalassemia 46 4.642 2.3
Iron metabolism disease 17 3.805 1.9
Neurodegenerative disease 383 3.526 1.8
Malaria 140 3.402 1.7
Kidney disease 396 3.202 1.6
Human immunodeficiency virus infectious ... 92  3.059 1.5
Hypersensitivity reaction type II diseas... 235  3.047 1.5
Alzheimer's disease 644
Arenaviridae Infections 1
Beta thalassemia 19
Bladder Neoplasm 109
Breast cancer 3,094
Chronic Lymphocytic Leukemia 242
Colorectal Neoplasms 217
Combined immunodeficiency 2
Duchenne muscular dystrophy 602
Finding of Mean Corpuscular Hemoglobin 14
Glioma 65
Helicobacter Infections 5
Inflammation 109
Iron Metabolism Disorders 5
Iron deficiency anemia 6
Lung Neoplasms 171
Lymphoma, Non-Hodgkin 22
Mammary Neoplasms 410
Multiple myeloma 1,327
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Neoplastic Cell Transformation 81
Obesity 616
Peripheral vascular disease 90 2.0
Pick disease 1,893
Polycystic Ovary Syndrome 332
Severe Combined Immunodeficiency 46
Spontaneous abortion 108
Waldenstrons macroglobulinemia 765
acute quadriplegic myopathy 1,157
astrocytic glioma 2,241
atypical teratoid/rhabdoid tumor 1,095
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
gastric carcinoma 832
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300 2.0
pilocytic astrocytoma 3,086
progressive supranuclear palsy 674
psoriasis 6,685
type II diabetes mellitus and post-ische... 89 
ulcerative colitis 2,087

Expression

Synonym

Accession P02786 D3DXB0 Q1HE24 Q59G55 Q9UCN0 Q9UCU5 Q9UDF9 Q9UK21 TR
Symbols T9
TR
TFR
p90
CD71
TFR1
TRFR
IMD46

Gene

PANTHER Protein Class (1)

PDB

1SUV   3S9L   3S9M   3S9N   1CX8   1DE4   2NSU   3KAS  

 GWAS Trait (1)

Gene RIF (178)

PMID Text
26869514 Together, our findings reveal that TfR1 can contribute to the mitochondrial respiration and ROS production, which have essential roles in growth and survival of pancreatic cancer.
26642240 The importance of TfR1 in adaptive immunity.A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 These results demonstrate that in cells expressing the hTfR, Tacaribe virus internalization depends on the presence of cholesterol, dynamin and acidic intracellular vesicles.
26441243 The requirement for a threshold level of TFR1 expression can explain why among primary human hematopoietic cells, only erythroblasts efficiently take up H-ferritin.
26394034 Data indicate only the glycoproteins CD34+/CD71low population showed statistically significant differences between Diamond-Blackfan Anaemia (DBA) patients and controls.
26392563 Data show that transferrin (Tf) was attached to nanoparticles with an acid-cleavable linkage that facilities release of nanoparticles from Tf that are bound to Tf receptors (TfR) during transcytosis, promoting entry of the nanoparticles into the brain.
26339443 Case Report: cellular iron deficit due to the low level of transferrin receptor, particularly in erythroid tissue.
26232328 This study provides insights into the effector functions of human IgG3 in the context of an antibody targeting TfR1.
26214738 elucidation of a signalling pathway whereby C18:0 stearoylates TFR1, thereby inhibiting its activation of JNK signaling; this leads to reduced ubiquitination of mitofusin via HUWE1, thereby promoting mitochondrial fusion and function
26079381 Data show that interleukin 6 (IL-6) secretion and the percentage of CD71 antigen-positive T lymphocytes both uniquely predicted survival independent of papillomavirus infection status.
More...

AA Sequence

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT      1 - 70
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF     71 - 140
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV    141 - 210
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL    211 - 280
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME    281 - 350
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG    351 - 420
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG    421 - 490
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED    491 - 560
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA    561 - 630
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV    631 - 700
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF              701 - 760
//

Text Mined References (253)

PMID Year Title
26869514 2016 Transferrin receptor regulates pancreatic cancer growth by modulating mitochondrial respiration and ROS generation.
26642240 2016 A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 2016 Human transferrin receptor triggers an alternative Tacaribe virus internalization pathway.
26441243 2015 H-Ferritin Is Preferentially Incorporated by Human Erythroid Cells through Transferrin Receptor 1 in a Threshold-Dependent Manner.
26394034 2015 Immunophenotypic Profiling of Erythroid Progenitor-Derived Extracellular Vesicles in Diamond-Blackfan Anaemia: A New Diagnostic Strategy.
26392563 2015 Increased brain uptake of targeted nanoparticles by adding an acid-cleavable linkage between transferrin and the nanoparticle core.
26339443 2015 An unusual case of iron deficiency anemia is associated with extremely low level of transferrin receptor.
26232328 2015 Insights into the effector functions of human IgG3 in the context of an antibody targeting transferrin receptor 1.
26214738 2015 Regulation of mitochondrial morphology and function by stearoylation of TFR1.
26079381 2015 In Vitro-Stimulated IL-6 Monocyte Secretion and In Vivo Peripheral Blood T Lymphocyte Activation Uniquely Predicted 15-Year Survival in Patients with Head and Neck Squamous Cell Carcinoma.
More...