Property Summary

NCBI Gene PubMed Count 263
PubMed Score 2558.28
PubTator Score 1690.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0
pancreatic cancer 2398 0.0 2.4

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy -1.169 4.0e-02
Alzheimer's disease -1.200 2.9e-02
astrocytic glioma -1.100 4.7e-02
Astrocytoma, Pilocytic -1.100 1.5e-04
atypical teratoid / rhabdoid tumor 1.400 8.2e-03
Breast cancer 1.400 7.8e-05
Duchenne muscular dystrophy 1.014 4.4e-02
ductal carcinoma in situ 1.500 9.4e-03
esophageal adenocarcinoma 1.200 3.1e-02
gastric carcinoma 1.600 3.3e-02
intraductal papillary-mucinous neoplasm ... 2.200 2.6e-03
invasive ductal carcinoma 1.400 1.1e-02
lung carcinoma -2.000 1.1e-20
medulloblastoma, large-cell 1.500 1.4e-03
Multiple myeloma 1.060 9.8e-03
nasopharyngeal carcinoma 1.400 3.5e-05
non diabetic and post-ischemic heart fai... -1.500 2.4e-03
non-small cell lung cancer 1.380 3.1e-05
ovarian cancer -1.400 3.3e-03
Pick disease -2.000 1.0e-04
progressive supranuclear palsy -1.100 8.6e-03
psoriasis 1.300 4.7e-03
type II diabetes mellitus and post-ische... -1.500 2.1e-02
ulcerative colitis -1.003 1.4e-02
Waldenstrons macroglobulinemia 1.876 1.7e-02

 OMIM Phenotype (1)

Gene RIF (193)

AA Sequence

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT      1 - 70
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF     71 - 140
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV    141 - 210
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL    211 - 280
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME    281 - 350
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG    351 - 420
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG    421 - 490
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED    491 - 560
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA    561 - 630
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV    631 - 700
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF              701 - 760
//

Text Mined References (273)

PMID Year Title