Property Summary

NCBI Gene PubMed Count 454
Grant Count 642
R01 Count 350
Funding $61,387,725.74
PubMed Score 1760.42
PubTator Score 1180.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (62)

Disease Z-score Confidence
tuberculosis 1,557 4.971 2.5
Hypersensitivity reaction type II diseas... 235  4.716 2.4
Influenza 142 4.651 2.3
Cancer 2,346 4.636 2.3
Lung disease 132 4.596 2.3
Multiple Sclerosis 498 4.588 2.3
Hepatitis C 90 4.427 2.2
Asthma 349 4.408 2.2
Encephalitis 54 4.343 2.2
Human immunodeficiency virus infectious ... 92  4.163 2.1
Vascular disease 281 4.006 2.0
Hepatitis 61 3.969 2.0
Arthritis 248 3.965 2.0
Severe acute respiratory syndrome 26 3.935 2.0
Dermatitis 107 3.913 2.0
psoriasis 6,685 3.894 1.9
Malaria 140 3.818 1.9
Eye disease 55 3.782 1.9
Cryoglobulinemia 15 3.729 1.9
Inflammatory bowel disease 142 3.669 1.8
diabetes mellitus 1,663 3.587 1.8
Dengue disease 19 3.446 1.7
Kidney disease 396 3.421 1.7
Hepatitis B 103 3.227 1.6
Tropical spastic paraparesis 17 3.058 1.5
Leprosy 77 3.022 1.5
Alopecia areata 37
Biliary cirrhosis 33
Brain Ischemia 87
Breast cancer 3,094
Colonic Neoplasms 126
Dermatitis, Atopic 45
Drug-Induced Liver Injury 118
Myocardial Ischemia 169
Spontaneous abortion 108
Thyroid Neoplasm 33
active Crohn's disease 918
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
facioscapulohumeral dystrophy 286
glioblastoma 5,572
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nasopharyngeal carcinoma 1,056
pancreatic cancer 2,300
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
sarcoidosis 358
ulcerative colitis 2,087

Expression

Synonym

Accession P02778 Q96QJ5
Symbols C7
IFI10
INP10
IP-10
crg-2
mob-1
SCYB10
gIP-10

Gene

PDB

1LV9   1O7Y   1O7Z   1O80  

Gene RIF (452)

PMID Text
27012046 Findings indicate high sensitivity and specificity of IP-10 as a novel biomarker for tuberculosis in China.
26907493 ANDV caused long-term elevated levels of eotaxin-1, IL-6, IL-8, IP-10, and VEGF-A that peaked 20-25 days after infection
26881918 Our results suggested that TNF-alpha may be an ideal biomarker for diagnosing the 3 forms of TB presentation, while the other factors (IL-6, IP-10, MCP-1, and IFN-gamma) can potentially facilitate differential diagnosis for the 3 TB presentation types
26861446 Metformin simultaneously increases VEGFA and reduces CXCL10 and TIMP1 in CD34(+) cells in a model of the diabetic state combined with hypoxia to stimulate angiogenesis.
26831417 Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1R
26786652 Report use of up-converting phosphor reporter technology in a lateral flow based test to determine IP-10 levels in pleural effusions and whole blood for tuberculosis diagnosis.
26771653 Interferon Gamma Inducible Protein 10 can be used as a Potential Biomarker in the Diagnosis of Latent Tuberculosis Infection
26708691 increased serum levels in 22q11.2 Deletion Syndrome patients
26687629 The results suggested that astrocytes contribute to Cerebral Malaria pathogenesis by producing CXCL10 in response to IFN-gamma and LT-alpha.
26658573 serum level preoperative period may serve as a predictive parameter for early liver allograft dysfunction
More...

AA Sequence

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG      1 - 70
EKRCLNPESKAIKNLLKAVSKERSKRSP                                               71 - 98
//

Text Mined References (454)

PMID Year Title
27012046 2016 Evaluation of a Whole Blood Chemiluminescent Immunoassay of Interferon-gamma Inducible Protein 10 (IP-10) for Diagnosis of Tuberculosis Patients.
26907493 2016 Andes Hantavirus-Infection of a 3D Human Lung Tissue Model Reveals a Late Peak in Progeny Virus Production Followed by Increased Levels of Proinflammatory Cytokines and VEGF-A.
26881918 2016 Analysis of Plasma Cytokine and Chemokine Profiles in Patients with and without Tuberculosis by Liquid Array-Based Multiplexed Immunoassays.
26861446 2016 Metformin improves the angiogenic potential of human CD34? cells co-incident with downregulating CXCL10 and TIMP1 gene expression and increasing VEGFA under hyperglycemia and hypoxia within a therapeutic window for myocardial infarction.
26831417 2015 Is CXCL10/CXCR3 axis overexpression a better indicator of leprosy type 1 reaction than inducible nitric oxide synthase?
26786652 2016 Use of lateral flow assays to determine IP-10 and CCL4 levels in pleural effusions and whole blood for TB diagnosis.
26771653 2016 The Use of Interferon Gamma Inducible Protein 10 as a Potential Biomarker in the Diagnosis of Latent Tuberculosis Infection in Uganda.
26708691 2016 Increased Levels of Interferon-Inducible Protein 10 (IP-10) in 22q11.2 Deletion Syndrome.
26687629 2016 Synergistic induction of CXCL10 by interferon-gamma and lymphotoxin-alpha in astrocytes: Possible role in cerebral malaria.
26658573 2016 Interferon-?, interleukin-10 and interferon-inducible protein 10 (CXCL10) as serum biomarkers for the early allograft dysfunction after liver transplantation.
More...