Property Summary

NCBI Gene PubMed Count 172
PubMed Score 2121.04
PubTator Score 1161.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis 1.712 2.0e-02
gastric cancer 1.500 3.8e-03
hepatocellular carcinoma 1.300 2.5e-03
malignant mesothelioma -1.400 3.4e-06
mucosa-associated lymphoid tissue lympho... 1.776 3.2e-02
non-small cell lung cancer -1.235 9.1e-12
osteosarcoma -3.761 8.6e-04
pancreatic cancer 2.000 7.5e-04
pancreatic carcinoma 2.000 7.5e-04

Protein-protein Interaction (2)

PDB (10)

Gene RIF (131)

AA Sequence

MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA      1 - 70
QLIATLKNGRKICLDLQAPLYKKIIKKLLES                                            71 - 101
//

Text Mined References (174)

PMID Year Title