Property Summary

NCBI Gene PubMed Count 159
Grant Count 262
R01 Count 93
Funding $56,546,209.87
PubMed Score 2045.54
PubTator Score 1161.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.500 0.004
hepatocellular carcinoma 1.300 0.003
pancreatic cancer 2.000 0.001
malignant mesothelioma -1.400 0.000
osteosarcoma -3.761 0.001
non-small cell lung cancer -1.235 0.000
ulcerative colitis 1.900 0.000
pancreatic carcinoma 2.000 0.001
mucosa-associated lymphoid tissue lympho... 1.776 0.032

Synonym

Accession P02776 Q53X61 Q9UC64 Q9UC65 PF-4
Symbols PF-4
CXCL4
SCYB4

Gene

PF4

PDB

1DN3   1F9Q   1F9R   1F9S   1PFM   1PFN   1RHP   4R9W   4R9Y   4RAU  

Gene RIF (116)

PMID Text
26810286 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion.
26524462 Results found that CXCL4 plasma levels did not differ between patients with and without coronary artery disease. Also, no association between CXCL4 levels and plaque characteristics including plaque volume, calcium score, or vascular remodeling.
26291604 A subset of heparin-treated patients produce subthreshold levels of platelet-activating anti-PF4/heparin antibodies that do not cause heparin-induced thrombocytopenia.
26256688 PF4 has a complex intramedullary life cycle with important implications in megakaryopoiesis and hematopoietic stem cell replication not seen with other tested alpha granule proteins.
26225544 PF4 changed its structure upon binding to polyP in a similar way as seen in PF4/heparin complexes. PF4/polyP complexes exposed neoepitopes to which human anti-PF4/heparin antibodies bound.
26142741 Data suggest that, in patients with hypothyroid autoimmune thyroiditis, PF4/CXCL4 serum levels are significantly lower in those with subclinical hypothyroidism than in euthyroid control subjects.
25960020 Heparin enhances antigen uptake and activation of the initial steps in the cellular immune response to PF4-containing complexes.
25858640 Synovial Cxcl4 mRNA and protein were increased in early rheumatoid arthritis compared to uninflamed controls and resolving arthritis.
25604035 PF4-heparin complexes can elicit a TLR4-mediated response, suggesting that these complexes can mimic a pathogen-associated molecular pattern, and supporting the suggestion that the HIT immune response represents a misdirected host defense mechanism.
25342714 although all HIT antibodies recognize PF4 in a complex with heparin, only a subset of these antibodies recognize more subtle epitopes induced in PF4 when it binds to CS, the major platelet glycosaminoglycan
More...

AA Sequence

MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA      1 - 70
QLIATLKNGRKICLDLQAPLYKKIIKKLLES                                            71 - 101
//

Text Mined References (161)

PMID Year Title
26810286 2016 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in patients with otitis media with effusion.
26524462 2015 CXCL4 Plasma Levels Are Not Associated with the Extent of Coronary Artery Disease or with Coronary Plaque Morphology.
26291604 2015 Distinguishing between anti-platelet factor 4/heparin antibodies that can and cannot cause heparin-induced thrombocytopenia.
26256688 2015 Intramedullary megakaryocytes internalize released platelet factor 4 and store it in alpha granules.
26225544 2015 Polyphosphates form antigenic complexes with platelet factor 4 (PF4) and enhance PF4-binding to bacteria.
26142741 2016 Low levels of circulating platelet factor 4 (PF4, CXCL4) in subclinically hypothyroid autoimmune thyroiditis.
25960020 2015 Heparin enhances uptake of platelet factor 4/heparin complexes by monocytes and macrophages.
25858640 2016 Expression of chemokines CXCL4 and CXCL7 by synovial macrophages defines an early stage of rheumatoid arthritis.
25604035 2015 Complexes of platelet factor 4 and heparin activate Toll-like receptor 4.
25342714 2015 Heparin-independent, PF4-dependent binding of HIT antibodies to platelets: implications for HIT pathogenesis.
More...