Property Summary

NCBI Gene PubMed Count 89
PubMed Score 1559.11
PubTator Score 1284.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.200 2.1e-02
Astrocytoma, Pilocytic 1.300 1.4e-03
chronic lymphosyte leukemia -1.800 4.2e-07
cystic fibrosis 1.900 3.3e-04
gastric cancer 1.200 1.9e-03
glioblastoma 1.100 1.8e-02
interstitial cystitis 2.500 2.5e-02
lung adenocarcinoma -1.300 9.4e-10
lung cancer -3.000 2.8e-05
lung carcinoma -2.100 1.9e-09
malignant mesothelioma -2.300 1.5e-07
mucosa-associated lymphoid tissue lympho... 2.954 1.9e-02
nephrosclerosis 1.342 3.4e-02
non-small cell lung cancer -3.159 7.4e-16
osteosarcoma -4.233 7.6e-03
ovarian cancer -1.400 1.5e-03
pancreatic cancer 1.300 1.1e-03
pancreatic carcinoma 1.300 1.1e-03
periodontitis 1.100 1.7e-12
Pick disease 1.400 3.0e-02
posterior fossa group A ependymoma 1.100 6.9e-03
psoriasis 1.700 2.5e-10
ulcerative colitis 1.800 2.2e-04

Gene RIF (41)

AA Sequence

MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTS      1 - 70
GIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD                 71 - 128
//

Text Mined References (91)

PMID Year Title