Property Summary

NCBI Gene PubMed Count 83
Grant Count 64
R01 Count 30
Funding $5,707,740.11
PubMed Score 1540.10
PubTator Score 1284.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis 1.342 0.034
gastric cancer 1.200 0.002
pancreatic cancer 1.300 0.001
malignant mesothelioma -2.300 0.000
osteosarcoma -4.233 0.008
chronic lymphosyte leukemia -1.800 0.000
glioblastoma 1.100 0.018
periodontitis 1.100 0.000
non-small cell lung cancer -3.159 0.000
lung cancer -3.000 0.000
interstitial cystitis 2.500 0.025
cystic fibrosis 2.100 0.000
lung adenocarcinoma -1.559 0.000
adult high grade glioma 1.200 0.021
pilocytic astrocytoma 1.300 0.002
posterior fossa group A ependymoma 1.100 0.007
pancreatic carcinoma 1.300 0.001
lung carcinoma -2.100 0.000
Pick disease 1.400 0.030
mucosa-associated lymphoid tissue lympho... 2.954 0.019
ulcerative colitis 1.800 0.000
ovarian cancer -1.400 0.001
psoriasis 1.700 0.000

Synonym

Accession P02775 B2R5F3 Q6IBJ8 PBP
Symbols PBP
TC1
TC2
TGB
LDGF
MDGF
TGB1
B-TG1
CTAP3
CXCL7
NAP-2
SCYB7
THBGB
LA-PF4
THBGB1
Beta-TG
CTAPIII
CTAP-III

Gene

PDB

1F9P   1NAP   1TVX  

Gene RIF (34)

PMID Text
26307429 Utilizing mass spectrometry-based proteomics, platelet basic protein has been identified as a candidate serum biomarker for transient ischemic attack
26297927 Studied and characterized the dynamics and thermodynamic stability of monomer and homodimer structures of CXCL7.
25989537 Leptin and neutrophil-activating peptide act synergistically to promote mesenchymal stem cell senescence through enhancement of the PI3K/Akt signaling pathway in systemic lupus erythematosus patients.
25858640 Synovial Cxcl7 mRNA and protein were increased in early rheumatoid arthritis compared to uninflamed controls and resolving arthritis.
25580640 CXCL7/CXCR2 signalling pathways are a predictive factor of poor outcome in metastatic colon cancer.
24991762 CXCR4-CXCL12-CXCR7 regulates mTOR signaling in renal cancer cells.
23619231 Testing of bacterial resistance to platelet antimicrobial lmw proteins (PMPs) may be advisable as a predictive indicator of susceptibility to treatment of infections such as infective endocarditis and other local infections of biofilm nature.
23052484 The level of beta-thromboglobulin was found significantly higher in female patients with rheumatoid arthritis.
22939812 beta-TG was evaluated for familial mediterranean fever cases and healthy controls, beta-TG levels were found significantly lower among patients; it is hypothesized that this difference may have resulted from the effect of colchicine use on platelet functions.
22740477 Examined the prognostic values of SARS-associated proteome, and deciphered the identities of those with prognostic values.The associations of decreased serum PF4 and increased serum beta-TG levels with poor prognosis were confirmed by Western blot.
More...

AA Sequence

MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTS      1 - 70
GIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD                 71 - 128
//

Text Mined References (85)

PMID Year Title
26307429 2015 Novel TIA biomarkers identified by mass spectrometry-based proteomics.
26297927 2015 Dynamics and thermodynamic properties of CXCL7 chemokine.
25989537 2015 Leptin and Neutrophil-Activating Peptide 2 Promote Mesenchymal Stem Cell Senescence Through Activation of the Phosphatidylinositol 3-Kinase/Akt Pathway in Patients With Systemic Lupus Erythematosus.
25858640 2016 Expression of chemokines CXCL4 and CXCL7 by synovial macrophages defines an early stage of rheumatoid arthritis.
25580640 2015 Overexpression of chemokine receptor CXCR2 and ligand CXCL7 in liver metastases from colon cancer is correlated to shorter disease-free and overall survival.
24991762 2014 CXCR4 and CXCR7 transduce through mTOR in human renal cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23619231 2013 Antimicrobial/anti-biofilm activity of expired blood platelets and their released products.
23052484 2013 The levels of ?-thromboglobulin in female rheumatoid arthritis patients as activation criteria.
22939812 2012 Mean platelet volume and ?-thromboglobulin levels in familial Mediterranean fever: effect of colchicine use?
More...