Property Summary

NCBI Gene PubMed Count 264
PubMed Score 11800.46
PubTator Score 10421.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
Breast cancer 3577 9.5e-15
malignant mesothelioma 3232 4.2e-08
psoriasis 6694 4.9e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -2.000 9.5e-15
malignant mesothelioma -2.800 4.2e-08
psoriasis -1.100 4.9e-03

 GO Function (1)

Gene RIF (241)

AA Sequence

MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDA      1 - 70
LTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQ     71 - 140
VPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVT    141 - 210
KELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQD    211 - 280
GEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIF    281 - 350
LASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ    351 - 420
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEM    421 - 490
TPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQK    491 - 560
PQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV                         561 - 609
//

Text Mined References (268)

PMID Year Title