Property Summary

NCBI Gene PubMed Count 240
Grant Count 356
R01 Count 177
Funding $59,762,604.85
PubMed Score 11505.13
PubTator Score 10421.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.800 0.000
Breast cancer -2.000 0.000
psoriasis -1.100 0.005

Synonym

Accession P02771 B2RBU3
Symbols AFPD
FETA
HPAFP

Gene

AFP

PANTHER Protein Class (1)

PDB

3MRK  

 GO Function (1)

Gene RIF (218)

PMID Text
27468575 Simultaneous determination of the AFP, AFP-L3 and TP53 yielded a better diagnostic accuracy and sensitivity in the detection of HCCs than each biomarker alone.
27070780 the accuracy of des-gamma-carboxy prothrombin for distinguishing hepatocellular carcinoma from various controls was 6.2-9.7% higher than that of AFP
26986465 AFP remained the best single marker, and the combined use of AFP with prothrombin precursor or DKK-1 had the best diagnostic performance compared to all other possible combinations of the four biomarkers, even in early stage hepatocellular carcinoma.
26968839 Data indicate the diagnostic criteria of chorionic gonadotropin beta subunit (beta-hCG) and alpha-Fetoprotein (alphaFP) in CSF and serum, which may advance the early and formal diagnosis of intracranial germ cell tumors (ICGCTs).
26927385 Data show that both Ezrin and SIX1 proteins are highly expressed in alpha fetoprotein-negative hepatocellular carcinoma (HCC) and significantly related with the TNM stage.
26887339 The risk of post-transplant hepatocellular carcinoma recurrence is dependent on the last pre-transplant AFP regardless of its previous dynamics.
26784252 High serum AFP is associated with hepatitis B virus infection-related hepatocellular carcinoma.
26782388 VEGF could be a potential biomarker for HCC, while AFP could be used to distinguish between patients with HCC and cirrhosis or HCV.
26756996 combination of circulating miR-126 + AFP is a promising noninvasive diagnostic biomarker for HBV-HCC and may be useful in the management of HCC patients.
26681337 Results show that AFP normalization within three months after stereotactic body radiotherapy (SBRT) is a prognostic surrogate for overall survival and progression free survival in patients with small hepatocellular carcinoma.
More...

AA Sequence

MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDA      1 - 70
LTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQ     71 - 140
VPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVT    141 - 210
KELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQD    211 - 280
GEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIF    281 - 350
LASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ    351 - 420
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEM    421 - 490
TPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQK    491 - 560
PQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV                         561 - 609
//

Text Mined References (244)

PMID Year Title
27468575 2016 Comparison of AFP-L3 and p53 Antigen Concentration with Alpha-Fetoprotein as Serum Markers for Hepatocellular Carcinoma.
27070780 2016 Diagnostic Evaluation of Des-Gamma-Carboxy Prothrombin versus ?-Fetoprotein for Hepatitis B Virus-Related Hepatocellular Carcinoma in China: A Large-Scale, Multicentre Study.
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26968839 2016 An update on the clinical diagnostic value of ?-hCG and ?FP for intracranial germ cell tumors.
26927385 2016 [Clinicopathological significance of ezrin and SIX1 protein expression in alpha fetoprotein-negative hepatocellular carcinoma].
26887339 2016 Relevance of Pre-Transplant ?-fetoprotein Dynamics in Liver Transplantation for Hepatocellular Cancer.
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26784252 2016 Alpha-fetoprotein still is a valuable diagnostic and prognosis predicting biomarker in hepatitis B virus infection-related hepatocellular carcinoma.
26782388 2015 Influence of vascular endothelial growth factor and alpha-fetoprotein on hepatocellular carcinoma.
26756996 2016 Hepatic miR-126 is a potential plasma biomarker for detection of hepatitis B virus infected hepatocellular carcinoma.
More...