Property Summary

NCBI Gene PubMed Count 420
PubMed Score 94572.86
PubTator Score 5011.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 6.54278903301979E-11
psoriasis 6685 2.43658449222151E-9
primary pancreatic ductal adenocarcinoma 1271 2.51310310862923E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.69806589149581E-4
pancreatic cancer 2300 4.07038028245653E-4
breast carcinoma 1614 0.00114845941659573
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00494067406508761
nephrosclerosis 329 0.00721004924656647
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0239391344400368
Disease Target Count Z-score Confidence
Kidney disease 397 8.186 4.0
diabetes mellitus 1663 7.458 3.7
Liver disease 219 7.262 3.6
Hypertension 293 6.751 3.4
Cancer 2346 6.484 3.2
protein-energy malnutrition 8 5.963 3.0
Anemia 252 5.955 3.0
Peritonitis 37 5.943 3.0
protein-losing enteropathy 11 5.766 2.9
Respiratory failure 30 5.651 2.8
Portal hypertension 21 5.528 2.8
Cerebrovascular disease 231 5.514 2.8
Brain disease 84 5.491 2.7
Hepatitis B 103 5.474 2.7
Coronary artery disease 240 5.433 2.7
Heart disease 279 5.274 2.6
Hypersensitivity reaction type II disease 235 5.269 2.6
Bilirubin metabolic disorder 39 5.23 2.6
Atherosclerosis 275 5.219 2.6
Pneumonia 133 5.174 2.6
Diarrhea 155 5.139 2.6
Diabetic Retinopathy 53 5.091 2.5
Cholestasis 93 5.083 2.5
Inflammatory bowel disease 142 4.977 2.5
Hyperglycemia 120 4.949 2.5
Obesity 616 4.928 2.5
Esophageal varix 10 4.91 2.5
Allergic hypersensitivity disease 123 4.885 2.4
Arthritis 248 4.801 2.4
Decubitus ulcer 10 4.775 2.4
Metabolic acidosis 49 4.75 2.4
tuberculosis 1563 4.716 2.4
Neuropathy 210 4.699 2.3
Hyperparathyroidism 43 4.685 2.3
Varicose veins 15 4.679 2.3
Peripheral vascular disease 90 4.671 2.3
Leukopenia 42 4.594 2.3
Metabolic syndrome X 155 4.574 2.3
Hyperthyroxinemia 9 4.56 2.3
Asthma 349 4.544 2.3
Lipid metabolism disorder 102 4.535 2.3
Ovarian hyperstimulation syndrome 15 4.512 2.3
Hepatitis C 90 4.428 2.2
Acquired immunodeficiency syndrome 164 4.208 2.1
Meningitis 46 4.184 2.1
Cholangitis 20 4.172 2.1
Chronic obstructive pulmonary disease 147 4.165 2.1
Autonomic neuropathy 21 4.153 2.1
Rhinitis 46 4.114 2.1
Amyloidosis 68 4.107 2.1
Arthus reaction 8 4.087 2.0
Hypercalcemia 37 4.072 2.0
Pulmonary Embolism 45 4.045 2.0
Multiple Sclerosis 498 4.042 2.0
Neonatal jaundice 15 4.018 2.0
Intestinal obstruction 16 3.996 2.0
Dementia 129 3.972 2.0
Bronchitis 44 3.926 2.0
Portal vein thrombosis 9 3.904 2.0
interstitial lung disease 292 3.897 1.9
Acute cystitis 37 3.884 1.9
Hypothyroidism 89 3.826 1.9
Malaria 140 3.821 1.9
Hyperhomocysteinemia 34 3.813 1.9
Kawasaki disease 24 3.799 1.9
Tetanus 66 3.795 1.9
Hyperphosphatemia 32 3.787 1.9
cystic fibrosis 1670 3.776 1.9
Pneumocystosis 18 3.762 1.9
Short bowel syndrome 16 3.698 1.8
Mastitis 48 3.609 1.8
Osteoporosis 259 3.608 1.8
Vasculitis 64 3.6 1.8
Hyperthyroidism 50 3.586 1.8
Hyperuricemia 35 3.582 1.8
Hypoglycemia 81 3.578 1.8
Alzheimer's disease 644 3.533 1.8
Fatty liver disease 86 3.472 1.7
Schistosomiasis 38 3.445 1.7
sarcoidosis 368 3.44 1.7
Periodontal disease 37 3.372 1.7
Lymphedema 26 3.3 1.6
Dermatitis 141 3.277 1.6
Leprosy 77 3.256 1.6
Exanthem 39 3.234 1.6
Eosinophilia 65 3.219 1.6
Meningoencephalitis 13 3.213 1.6
Substance abuse 55 3.205 1.6
Diphtheria 23 3.155 1.6
Alcohol dependence 107 3.135 1.6
Tropical sprue 5 3.124 1.6
Capillary leak syndrome 2 3.123 1.6
Thrombophilia 37 3.101 1.6
Visceral leishmaniasis 14 3.098 1.5
Hypersplenism 9 3.076 1.5
Thyrotoxicosis 38 3.076 1.5
Polycystic kidney disease 54 3.074 1.5
Otitis media 32 3.066 1.5
Polyneuropathy 30 3.052 1.5
Bronchiectasis 29 3.03 1.5
Pyuria 6 3.03 1.5
Peptic ulcer disease 11 3.023 1.5
Hypertensive retinopathy 9 3.021 1.5
Influenza 142 3.013 1.5

Expression

See source...

Synonym

Accession P02768 E7ESS9 O95574 P04277 Q13140 Q645G4 Q68DN5 Q6UXK4 Q86YG0 Q8IUK7 Q9P157 Q9P1I7 Q9UHS3 Q9UJZ0
Symbols HSA
PRO0883
PRO0903
PRO1341

Gene

ALB

PANTHER Protein Class (1)

PDB

4K71   4N0F   4N0U   1AO6   1BJ5   1BKE   1BM0   1E78   1E7A   1E7B   1E7C   1E7E   1E7F   1E7G   1E7H   1E7I   1GNI   1GNJ   1H9Z   1HA2   1HK1   1HK2   1HK3   1HK4   1HK5   1N5U   1O9X   1TF0   1UOR   1YSX   2BX8   2BXA   2BXB   2BXC   2BXD   2BXE   2BXF   2BXG   2BXH   2BXI   2BXK   2BXL   2BXM   2BXN   2BXO   2BXP   2BXQ   2ESG   2I2Z   2I30   2N0X   2VDB   2VUE   2VUF   2XSI   2XVQ   2XVU   2XVV   2XVW   2XW0   2XW1   2YDF   3A73   3B9L   3B9M   3CX9   3JQZ   3JRY   3LU6   3LU7   3LU8   3SQJ   3TDL   3UIV   4BKE   4E99   4EMX   4G03   4G04   4HGK   4HGM   4IW1   4IW2   4K2C   4L8U   4L9K   4L9Q   4LA0   4LB2   4LB9   4S1Y   4Z69   5FUO   5ID7   5IFO   5IJF  

  Ortholog (11)

Gene RIF (302)

PMID Text
27346974 The results showed that both patients are homozygous for the deletion of a cytosine residue in exon 5, in a stretch of four cytosines starting from nucleotide position 524 and ending at position 527 (NM_000477.5(ALB):c.527delC).
27015568 Our study is one of the first to describe how pre-operative BMI and serum albumin and post-operative changes in these variables impact clinical and perioperative outcomes
26764252 Decreased serum albumin levels in cancer patients were significantly associated with increased risk of VTE and mortality. Serum albumin, a marker of a cancer patient's overall prognosis, could be considered for risk assessment of important clinical outcomes such as VTE and mortality.
26554815 Data suggest that ALB exhibits homodimerization via free cysteine-34, without any potentially immunogenic cross-linkers that are usually prerequisites for homodimerization of amyloidogenic proteins.
26549058 While the weakly interacting HSA NPs did not alter the aggregation kinetic parameters of alphaSN, the rate of primary nucleation increased in the presence of PEI-HSA NPs.
26530188 Data indicate that antecedent C-reactive protein (CRP) was associated with future serum albumin.
26484352 In multivariable linear regression analyses, DeltaGA/HbA1c was independently associated with diabetes duration. In conclusion, this study demonstrated that serum GA levels increase relative to HbA1c levels with time.
26474241 this study explored the details of imidazole derivatives binding to human serum albumin.
26448295 Drospirenone had different effects on the local conformation of HSA and LYZ molecules.
26433342 The influence of glycation process on serum albumin binding to 5-dimethylaminonaphthalene-1-sulfonamide (DNSA), 2-(p-toluidino) naphthalene-6-sulfonic acid (TNS), has been studied.
More...

AA Sequence

MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEV      1 - 70
TEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLV     71 - 140
RPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELR    141 - 210
DEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADD    211 - 280
RADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVF    281 - 350
LGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE    351 - 420
QLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK    421 - 490
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHK    491 - 560
PKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL                         561 - 609
//

Text Mined References (434)

PMID Year Title
27346974 2016 A nucleotide deletion and frame-shift cause analbuminemia in a Turkish family.
27226040 2016 Hyperglycemia induced structural and functional changes in human serum albumin of diabetic patients: a physico-chemical study.
27164421 2016 Serum albumin attenuates the open-channel blocking effects of propofol on the human Kv1.5 channel.
27048041 2016 Correlation of serum albumin with the clinical features and prognosis of preterm neonates in the neonatal intensive care unit.
27015568 2016 Influence of Body Mass Index and Albumin on Perioperative Morbidity and Clinical Outcomes in Resected Pancreatic Adenocarcinoma.
26965637 2016 Proteolytic processing of human serum albumin generates EPI-X4, an endogenous antagonist of CXCR4.
26951925 2016 Human plasma lipocalins and serum albumin: Plasma alternative carriers?
26909491 2016 Thymosin ?1 Interacts with Exposed Phosphatidylserine in Membrane Models and in Cells and Uses Serum Albumin as a Carrier.
26901698 2016 Albumin and apolipoprotein H mRNAs in human plasma as potential clinical biomarkers of liver injury: analyses of plasma liver-specific mRNAs in patients with liver injury.
26764252 2016 Association Between Decreased Serum Albumin With Risk of Venous Thromboembolism and Mortality in Cancer Patients.
More...