Property Summary

Ligand Count 29
NCBI Gene PubMed Count 473
PubMed Score 6198.34
PubTator Score 2584.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Amyloidosis 67
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.1
Disease Target Count Z-score Confidence
Transthyretin amyloidosis 1 0.0 5.0
Disease Target Count
Lattice corneal dystrophy 8

Expression

  Differential Expression (7)

Disease log2 FC p
diabetes mellitus 1.200 1.5e-03
group 3 medulloblastoma 2.600 3.5e-02
intraductal papillary-mucinous adenoma (... -2.300 1.3e-02
intraductal papillary-mucinous carcinoma... -2.400 1.8e-02
lung carcinoma 2.500 2.6e-09
osteosarcoma 2.060 1.3e-06
psoriasis 1.300 7.7e-04

Synonym

Accession P02766 Q549C7 Q6IB96 Q9UBZ6 Q9UCM9
Symbols CTS
ATTR
CTS1
PALB
TBPA
HEL111
HsT2651

Gene

TTR

PANTHER Protein Class (1)

PDB

1BM7   1BMZ   1BZ8   1BZD   1BZE   1DVQ   1DVS   1DVT   1DVU   1DVX   1DVY   1DVZ   1E3F   1E4H   1E5A   1ETA   1ETB   1F41   1F64   1F86   1FH2   1FHN   1G1O   1GKO   1ICT   1III   1IIK   1IJN   1QAB   1QWH   1RLB   1SOK   1SOQ   1THA   1THC   1TLM   1TSH   1TT6   1TTA   1TTB   1TTC   1TTR   1TYR   1TZ8   1U21   1X7S   1X7T   1Y1D   1Z7J   1ZCR   1ZD6   2B14   2B15   2B16   2B77   2B9A   2F7I   2F8I   2FBR   2FLM   2G3X   2G3Z   2G4E   2G4G   2G5U   2G9K   2GAB   2H4E   2M5N   2NBO   2NBP   2NOY   2PAB   2QEL   2QGB   2QGC   2QGD   2QGE   2ROX   2ROY   2TRH   2TRY   2WQA   3A4D   3A4E   3A4F   3B56   3BSZ   3BT0   3CBR   3CFM   3CFN   3CFQ   3CFT   3CN0   3CN1   3CN2   3CN3   3CN4   3CXF   3D2T   3D7P   3DGD   3DID   3DJR   3DJS   3DJT   3DJZ   3DK0   3DK2   3DO4   3ESN   3ESO   3ESP   3FC8   3FCB   3GLZ   3GPS   3GRB   3GRG   3GS0   3GS4   3GS7   3HJ0   3I9A   3I9I   3I9P   3IMR   3IMS   3IMT   3IMU   3IMV   3IMW   3IPB   3IPE   3KGS   3KGT   3KGU   3M1O   3NEE   3NEO   3NES   3NEX   3NG5   3OZK   3OZL   3P3R   3P3S   3P3T   3P3U   3SSG   3TCT   3TFB   3U2I   3U2J   3W3B   4ABQ   4ABU   4ABV   4ABW   4AC2   4AC4   4ACT   4ANK   4D7B   4DER   4DES   4DET   4DEU   4DEW   4FI6   4FI7   4FI8   4HIQ   4HIS   4HJS   4HJT   4HJU   4I85   4I87   4I89   4IIZ   4IK6   4IK7   4IKI   4IKJ   4IKK   4IKL   4KY2   4L1S   4L1T   4MAS   4MRB   4MRC   4N85   4N86   4N87   4PM1   4PME   4PMF   4PVL   4PVM   4PVN   4PWE   4PWF   4PWG   4PWH   4PWI   4PWJ   4PWK   4QRF   4QXV   4QYA   4TKW   4TL4   4TL5   4TLK   4TLS   4TLT   4TLU   4TM9   4TNE   4TNF   4TNG   4TQ8   4TQH   4TQI   4TQP   4WNJ   4WNS   4WO0   4Y9B   4Y9C   4Y9E   4Y9F   4Y9G   4YDM   4YDN   5A6I   5AKS   5AKT   5AKV   5AL0   5AL8   5AYT   5BOJ   5CLX   5CLY   5CLZ   5CM1   5CN3   5CNH   5CR1   5DEJ   5DWP   5E23   5E4A   5E4O   5EN3   5EZP   5FO2   5FW6   5FW7   5FW8   5H0V   5H0W   5H0X   5H0Y   5H0Z   5HJG   5IHH   5JID   5JIM   5JIQ   5K1J   5K1N   5L4F   5L4I   5L4J   5L4M   5LLL   5LLV   5TTR   5TZL   5U48   5U49   5U4A   5U4B   5U4C   5U4D   5U4E   5U4F   5U4G  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (332)

AA Sequence

MASHRLLLLCLAGLVFVSEAGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTS      1 - 70
ESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA     71 - 140
VVTNPKE                                                                   141 - 147
//

Text Mined References (509)

PMID Year Title