Property Summary

NCBI Gene PubMed Count 445
Grant Count 473
R01 Count 251
Funding $135,001,486.8
PubMed Score 5822.82
PubTator Score 2584.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 2.060 0.000
intraductal papillary-mucinous adenoma (... -2.300 0.013
intraductal papillary-mucinous carcinoma... -2.400 0.018
diabetes mellitus 1.200 0.001
group 3 medulloblastoma 2.600 0.035
lung carcinoma 2.500 0.000

Synonym

Accession P02766 Q549C7 Q6IB96 Q9UBZ6 Q9UCM9
Symbols CTS
CTS1
PALB
TBPA
HEL111
HsT2651

Gene

TTR

PANTHER Protein Class (1)

PDB

1BM7   1BMZ   1BZ8   1BZD   1BZE   1DVQ   1DVS   1DVT   1DVU   1DVX   1DVY   1DVZ   1E3F   1E4H   1E5A   1ETA   1ETB   1F41   1F64   1F86   1FH2   1FHN   1G1O   1GKO   1ICT   1III   1IIK   1IJN   1QAB   1QWH   1RLB   1SOK   1SOQ   1THA   1THC   1TLM   1TSH   1TT6   1TTA   1TTB   1TTC   1TTR   1TYR   1TZ8   1U21   1X7S   1X7T   1Y1D   1Z7J   1ZCR   1ZD6   2B14   2B15   2B16   2B77   2B9A   2F7I   2F8I   2FBR   2FLM   2G3X   2G3Z   2G4E   2G4G   2G5U   2G9K   2GAB   2H4E   2M5N   2NOY   2PAB   2QEL   2QGB   2QGC   2QGD   2QGE   2ROX   2ROY   2TRH   2TRY   2WQA   3A4D   3A4E   3A4F   3B56   3BSZ   3BT0   3CBR   3CFM   3CFN   3CFQ   3CFT   3CN0   3CN1   3CN2   3CN3   3CN4   3CXF   3D2T   3D7P   3DGD   3DID   3DJR   3DJS   3DJT   3DJZ   3DK0   3DK2   3DO4   3ESN   3ESO   3ESP   3FC8   3FCB   3GLZ   3GPS   3GRB   3GRG   3GS0   3GS4   3GS7   3HJ0   3I9A   3I9I   3I9P   3IMR   3IMS   3IMT   3IMU   3IMV   3IMW   3IPB   3IPE   3KGS   3KGT   3KGU   3M1O   3NEE   3NEO   3NES   3NEX   3NG5   3OZK   3OZL   3P3R   3P3S   3P3T   3P3U   3SSG   3TCT   3TFB   3U2I   3U2J   3W3B   4ABQ   4ABU   4ABV   4ABW   4AC2   4AC4   4ACT   4ANK   4D7B   4DER   4DES   4DET   4DEU   4DEW   4FI6   4FI7   4FI8   4HIQ   4HIS   4HJS   4HJT   4HJU   4I85   4I87   4I89   4IIZ   4IK6   4IK7   4IKI   4IKJ   4IKK   4IKL   4KY2   4L1S   4L1T   4MAS   4MRB   4MRC   4N85   4N86   4N87   4PM1   4PME   4PMF   4PVL   4PVM   4PVN   4PWE   4PWF   4PWG   4PWH   4PWI   4PWJ   4PWK   4QRF   4QXV   4QYA   4TKW   4TL4   4TL5   4TLK   4TLS   4TLT   4TLU   4TM9   4TNE   4TNF   4TNG   4TQ8   4TQH   4TQI   4TQP   4WNJ   4WNS   4WO0   4Y9B   4Y9C   4Y9E   4Y9F   4Y9G   4YDM   4YDN   5A6I   5AKS   5AKT   5AKV   5AL0   5AL8   5AYT   5BOJ   5CLX   5CLY   5CLZ   5CM1   5CN3   5CNH   5CR1   5DEJ   5DWP   5E23   5E4A   5E4O   5EN3   5EZP   5HJG   5IHH   5K1J   5K1N   5TTR  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
1117267 screening 1155 / 0 / 90788 Luminescence-based cell-based primary high throughput screening assay to identify activators of Transthyretin (TTR) transcription
1117268 summary 0 / 0 / 0 Summary of probe development efforts to identify activators of Transthyretin (TTR) transcription
1117279 screening 39 / 0 / 1044 Counterscreen for activators of Transthyretin (TTR) transcription: Luminescence-based cell-based high throughput assay to identify inhibitors of Transthyretin (TTR) transcription in HuH7 hepatoma cells
1117280 screening 8 / 0 / 1075 Luminescence-based cell-based high throughput confirmation assay to identify activators of Transthyretin (TTR) transcription
1117296 confirmatory 0 / 0 / 55 Counterscreen for activators of Transthyretin (TTR) transcription: Luminescence-based cell-based high throughput dose response assay to identify inhibitors of Transthyretin (TTR) transcription in HuH7 hepatoma cells
1117297 confirmatory 0 / 0 / 55 Luminescence-based cell-based high throughput dose response assay to identify activators of Transthyretin (TTR) transcription

Gene RIF (305)

PMID Text
26998642 Data suggest that well-structured AB loop regions of TTR in native/homotetrameric/stable state become dissociated/disordered/unfolded at low pH; during refolding, structural perturbations in AB loop appear and facilitate misfolding and amyloid formation.
26656838 Large differences in survival were observed in hereditary transthyretin amyloidosis patients with TTR mutations other than Val30Met.
26587769 illustrates the diversity of symptoms encountered in homozygote ATTR V30M patients
26527142 Eight water molecules stabilize the dimeric structure through an extensive hydrogen-bonding network.
26459562 beta-strands F and H as necessary for TTR aggregation.
26444765 Study elucidated alterations in TTR, APP and the global gene expression profile in the frontal cortex between idiopathic normal pressure hydrocephalus patients and nondemented control brain
26428663 Caucasian patients with the Val142Ile pathogenic variant have phenotypic manifestations similar to African-Americans
26369527 Ile107Val and LateMet30 TTR mutations are associated with the most debilitating and severe familial amyloid polyneuropathy, with rapid onset of tetraparesis and shorter median survival.
26249340 The structures of TTR in complex with three natural polyphenols (pterostilbene, quercetin and apigenin) have been determined.
26003908 In critically ill trauma patients, low serum TTR level is associated with poorer clinical outcomes.
More...

AA Sequence

MASHRLLLLCLAGLVFVSEAGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTS      1 - 70
ESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA     71 - 140
VVTNPKE                                                                   141 - 147
//

Text Mined References (481)

PMID Year Title
26998642 2016 Structural Changes Associated with Transthyretin Misfolding and Amyloid Formation Revealed by Solution and Solid-State NMR.
26656838 2016 Survival After Transplantation in Patients With Mutations Other Than Val30Met: Extracts From the FAP World Transplant Registry.
26587769 2015 Two brothers homozygous for the TTR V30M both presenting with a phenotype dominated by central nervous complications.
26527142 2015 The putative role of some conserved water molecules in the structure and function of human transthyretin.
26459562 2015 Uncovering the Mechanism of Aggregation of Human Transthyretin.
26444765 2015 The Expression of Transthyretin and Amyloid-? Protein Precursor is Altered in the Brain of Idiopathic Normal Pressure Hydrocephalus Patients.
26428663 2016 The Val142Ile transthyretin cardiac amyloidosis: not only an Afro-American pathogenic variant? A single-centre Italian experience.
26369527 2015 Genotype-phenotype correlation and course of transthyretin familial amyloid polyneuropathies in France.
26249340 2015 Structural evidence for asymmetric ligand binding to transthyretin.
26003908 2015 Serum transthyretin is a predictor of clinical outcomes in critically ill trauma patients.
More...