Property Summary

NCBI Gene PubMed Count 259
PubMed Score 1300.30
PubTator Score 729.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.9e-04

 GWAS Trait (1)

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (231)

AA Sequence

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP      1 - 70
QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE     71 - 140
DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA    141 - 210
KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS    211 - 280
PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA    281 - 350
AGPVVPPCPGRIRHFKV                                                         351 - 367
//

Text Mined References (272)

PMID Year Title