Property Summary

NCBI Gene PubMed Count 233
Grant Count 124
R01 Count 58
Funding $29,274,135.19
PubMed Score 1210.98
PubTator Score 729.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Synonym

Accession P02765 A8K9N6 B2R7G1 O14961 O14962 Q9P152
Symbols AHS
A2HS
HSGA
FETUA

Gene

Gene RIF (210)

PMID Text
26549924 results indicated that the cis-regulatory expressional difference of AHSG is expected to occur at the level of transcription or splicing of mRNA
26464644 AHSG is up-regulated in hypopharyngeal squamous cell carcinoma may be employed as a potential biomarker for its early diagnosis
26448929 Reanalysis of a total of 47 MDS patients revealed biomarker candidates, with alpha-2-HS-glycoprotein and leucine-rich alpha-2-glycoprotein as the most promising candidates.
26426614 serum concentrations significantly associated with elevated fatty liver index, ALT, and AST, the early indicators of nonalcoholic fatty liver disease
26343871 Common variants in the AHSG gene are strongly associated with fetuin-A levels, but their concurrent association with CHD risk in current prospective studies is inconsistent
26214492 The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.
26181150 The aim of this article is to summarize, comment and order previous knowledge about Fetuin-A.
26156593 Data suggest that serum fetuin-A (FETUA/AHSG) concentrations are signi fi cantly positively associated with serum VEGFA (vascular endothelial growth factor A) levels in patients with newly diagnosed type 2 diabetes.
25978344 Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome.
25888842 These findings establish urinary Fetuin-A as a sensitive biomarker of the progression of autosomal dominant polycystic kidney disease.
More...

AA Sequence

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP      1 - 70
QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE     71 - 140
DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA    141 - 210
KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS    211 - 280
PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA    281 - 350
AGPVVPPCPGRIRHFKV                                                         351 - 367
//

Text Mined References (246)

PMID Year Title
26549924 2015 Allelic Imbalance of mRNA Associated with ?2-HS Glycoprotein (Fetuin-A) Polymorphism.
26464644 2015 Proteomic identification of alpha-2-HS-glycoprotein as a plasma biomarker of hypopharyngeal squamous cell carcinoma.
26448929 2015 Plasma Protein Biomarker Candidates for Myelodysplastic Syndrome Subgroups.
26426614 2015 Serum Fetuin-A Associated With Fatty Liver Index, Early Indicator of Nonalcoholic Fatty Liver Disease: A Strobe-Compliant Article.
26343871 2015 Fetuin-A and risk of coronary heart disease: A Mendelian randomization analysis and a pooled analysis of AHSG genetic variants in 7 prospective studies.
26214492 2015 Correlation of plasma soluble cluster of differentiation 40 ligand, alpha fetoprotein A, and pregnancy-associated plasma protein A with carotid plaque in patients with ischemic stroke.
26181150 2015 [Fetuin-A and its role in important processes in organism. From nanobacteries to nanoparticles. Attempt to summarize available information].
26156593 2015 Serum fetuin-A concentrations are positively associated with serum VEGF levels in patients with newly diagnosed type 2 diabetes.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25978344 2015 Increased adipose tissue secretion of Fetuin-A, lipopolysaccharide-binding protein and high-mobility group box protein 1 in metabolic syndrome.
More...