Property Summary

NCBI Gene PubMed Count 93
Grant Count 12
R01 Count 3
Funding $848,004.7
PubMed Score 141.65
PubTator Score 158.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -5.158 0.000
adrenocortical adenoma -1.308 0.002
sarcoidosis -1.200 0.021
psoriasis 1.600 0.000

Gene RIF (66)

PMID Text
26563517 Altogether, these results indicate that alpha1-3 fucosylated glycoforms of AGP are increased in PDAC and could be potentially regarded as a PDAC biomarker.
26563422 Glycosylated Alpha-1-acid glycoprotein 1 is ostensibly expressed in lung cancer patients and is a potential lung cancer serum biomarker.
26193215 The results of this study suggest that the expression of VEGF-A and ORM-1 may be associated with two mechanisms (angiogenesis and tumor structural viscosity) that may influence tumor growth in odontogenic myxoma.
25689617 ORM1 stimulates quiescent monocytes to polarize to M2b monocytes.
25408356 Data indicate that the band intensity of sialic acid content in alpha-1 Acid glycoprotein (AGP) of alcoholic liver cirrhosis was found to be lower than that in pooled control group.
24389491 These findings suggest that the ORM distal promoter region differentially regulates expression of ORM genes at basal level and in acute phase responses.
24359035 Data suggest that human serum albumin (HSA) might serve as a carrier in delivering chitooligomers to target tissues than alpha-1-glycoprotein (AGP) which has pharmacological importance
24357727 Identified is the ORM1 gene, coding for orosomucoid, as a novel locus associated with lag time variability, reflecting the initiation process of thrombin generation.
23973664 The ORM1 may be considered as a signaling molecule involved in the maintenance of tissue homeostasis and remodeling.
23940561 The ORM1 A113G polymorphism was associated with the PKs variability after taking telmsiartan, as well as ABCC2 C3972T. The heterozygotes of ORM1 113AG showed a larger AUC and a notable BP change(%) from the baseline compared with the wild-type.
More...

AA Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFT      1 - 70
PNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNW     71 - 140
GLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES             141 - 201
//

Text Mined References (99)

PMID Year Title
26563517 2016 Increased ?1-3 fucosylation of ?-1-acid glycoprotein (AGP) in pancreatic cancer.
26563422 2016 Glycosylated Alpha-1-acid glycoprotein 1 as a potential lung cancer serum biomarker.
26193215 2015 Immunolocalization of VEGF-A and orosomucoid-1 in odontogenic myxoma.
25689617 2015 Orosomucoid 1 drives opportunistic infections through the polarization of monocytes to the M2b phenotype.
25408356 2015 Structural heterogeneity of glycoform of alpha-1 Acid glycoprotein in alcoholic cirrhosis patients.
24389491 2014 Distal promoter regions are responsible for differential regulation of human orosomucoid-1 and -2 gene expression and acute phase responses.
24359035 2015 Differential interactions and structural stability of chitosan oligomers with human serum albumin and ?-1-glycoprotein.
24357727 2014 A meta-analysis of genome-wide association studies identifies ORM1 as a novel gene controlling thrombin generation potential.
23973664 2013 The Orosomucoid 1 protein is involved in the vitamin D - mediated macrophage de-activation process.
23940561 2013 Polymorphism of ORM1 is associated with the pharmacokinetics of telmisartan.
More...