Property Summary

NCBI Gene PubMed Count 98
PubMed Score 145.81
PubTator Score 158.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Failure 73 0.0 0.0
Disease Target Count
Depressed mood 17
Disease Target Count P-value
osteosarcoma 7950 7.2e-09
psoriasis 6694 2.1e-04
adrenocortical adenoma 131 1.7e-03
sarcoidosis 370 2.1e-02
Disease Target Count Z-score Confidence
Asthma 385 3.098 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical adenoma -1.308 1.7e-03
osteosarcoma -5.158 7.2e-09
psoriasis 1.600 2.1e-04
sarcoidosis -1.200 2.1e-02

Gene RIF (67)

AA Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFT      1 - 70
PNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNW     71 - 140
GLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES             141 - 201
//

Text Mined References (104)

PMID Year Title