Property Summary

NCBI Gene PubMed Count 106
Grant Count 73
R01 Count 34
Funding $10,224,416.87
PubMed Score 405.24
PubTator Score 447.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02760 P00977 P02759 P78491 Q2TU33 Q5TBD7 Q9UC58 Q9UDI8
Symbols A1M
HCP
ITI
UTI
EDC1
HI30
ITIL
IATIL
ITILC

Gene

PDB

1BIK   3QKG   4ES7   4U30  

Gene RIF (53)

PMID Text
26728454 Data suggest that Mg2+ or Mn2+ (but not Ca2+) induce a conformational change in inter-alpha-inhibitor (ITIH1 and ITIH2) and a bikunin/chondroitin sulfate-dependent increase in thermodynamic stability; bikunin binds adjacent to the two heavy chains.
26681130 Prophylactic UTI maintains the endothelial barrier function, increases VE-cadherin expression, and inhibits the phosphorylation of VE-cadherin at Tyr658 under inflammatory conditions
26497278 Data indicate that two heme groups can be bound simultaneously at separate sites in the antioxidant alpha1-microglobulin.
25561734 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25555815 results indicate a reduced UTI level in CSF of MS and NMO patients. The levels were associated with the severity of the two demyelinating diseases during relapse
25370597 Proximal tubular dysfunction, indicated by urine alpha1-microglobulin, was independently associated with kidney function decline in HIV-infected and uninfected women and mortality risk among HIV-infected women.
24980765 Decreased bikunin mRNA level in renal cells might be associated with poor prognosis of renal carcinoma.
24698819 placental alpha microglobulin-1 is a sensitive and specific test to assess rupture of membranes in patients with an equivocal diagnosis based on simple tests
24211404 Label-free quantitative comparison of DN urinary exosomes vs control group and SRM further validation, resulted in the discovery of a panel of three proteins (AMBP, MLL3 and VDAC1) which changes in DN.
24135868 The high level of serum AMBP could predict the poor response of the AGC patients.
More...

AA Sequence

MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL      1 - 70
GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR     71 - 140
HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ    141 - 210
EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT    211 - 280
CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF    281 - 350
SN                                                                        351 - 352
//

Text Mined References (112)

PMID Year Title
26728454 2016 The Compact and Biologically Relevant Structure of Inter-?-inhibitor Is Maintained by the Chondroitin Sulfate Chain and Divalent Cations.
26681130 2016 Urinary trypsin inhibitor attenuates LPS-induced endothelial barrier dysfunction by upregulation of vascular endothelial-cadherin expression.
26497278 2016 Structural and biochemical characterization of two heme binding sites on ?1-microglobulin using site directed mutagenesis and molecular simulation.
26202000 2015 High-level secretion of human bikunin from recombinant Pichia pastoris.
25561734 2015 Heavy chain transfer by tumor necrosis factor-stimulated gene 6 to the bikunin proteoglycan.
25555815 2015 Urinary trypsin inhibitor levels are reduced in cerebrospinal fluid of multiple sclerosis and neuromyelitis optica patients during relapse.
25416956 2014 A proteome-scale map of the human interactome network.
25370597 2015 Association of urine ?1-microglobulin with kidney function decline and mortality in HIV-infected women.
24980765 2014 Reduced gene expression of bikunin as a prognostic marker for renal cell carcinoma.
24698819 2014 Comparison of placental alpha microglobulin-1 in vaginal fluid with intra-amniotic injection of indigo carmine for the diagnosis of rupture of membranes.
More...