Property Summary

NCBI Gene PubMed Count 109
PubMed Score 420.07
PubTator Score 447.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

AA Sequence

MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL      1 - 70
GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR     71 - 140
HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ    141 - 210
EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT    211 - 280
CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF    281 - 350
SN                                                                        351 - 352
//

Text Mined References (115)

PMID Year Title