Property Summary

NCBI Gene PubMed Count 272
Grant Count 73
R01 Count 23
Funding $5,782,422.73
PubMed Score 524.89
PubTator Score 1314.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Obesity 616 5.134 2.6
diabetes mellitus 1,663 4.934 2.5
Metabolic syndrome X 155 4.831 2.4
Fatty liver disease 84 3.972 2.0
Matthew-Wood syndrome 10 3.57 1.8
Lipid metabolism disorder 102 3.352 1.7
Polycystic Ovary Syndrome 332 3.268 1.6
Hyperglycemia 120 3.1 1.6
Alcoholic Liver Diseases 3
Animal Mammary Neoplasms 136
Atopic dermatitis 944
Keratomalacia 6
Kidney Diseases 86
Mammary Neoplasms, Experimental 150
Microphthalmia 78 4.0
Mineral Deficiency Prevention 1
Mineral deficiency 1
Necrosis 51
Pick disease 1,893
Prevention of dental caries 2
RETINAL DYSTROPHY, IRIS COLOBOMA, AND CO... 1 
Spontaneous abortion 108
Stomach Neoplasms 282
Vitamin A Deficiency 5
Vitamin Deficiency Prevention 2
Vitamin deficiency 3
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
aldosterone-producing adenoma 664
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma multiforme 347
inflammatory breast cancer 404
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma 1,524
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sarcoidosis 358

Expression

  Differential Expression (34)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
astrocytic glioma -3.600 0.001
oligodendroglioma -3.400 0.004
psoriasis 1.900 0.002
glioblastoma multiforme -3.000 0.000
posterior fossa group B ependymoma -2.700 0.000
medulloblastoma -3.600 0.000
cystic fibrosis 1.500 0.019
atypical teratoid / rhabdoid tumor -3.000 0.000
primitive neuroectodermal tumor -2.500 0.013
autosomal dominant Emery-Dreifuss muscul... 2.106 0.007
acute quadriplegic myopathy 1.545 0.000
Atopic dermatitis -2.300 0.008
adrenocortical adenoma -2.976 0.000
adrenocortical carcinoma -2.944 0.000
non-small cell lung cancer -2.285 0.000
lung cancer -1.800 0.000
active ulcerative colitis 1.720 0.033
sarcoidosis -1.900 0.027
breast carcinoma -3.300 0.001
fibroadenoma -4.000 0.013
interstitial cystitis -3.500 0.000
lung adenocarcinoma -2.000 0.000
adult high grade glioma -3.300 0.002
pilocytic astrocytoma -3.700 0.000
non primary Sjogren syndrome sicca 1.800 0.014
aldosterone-producing adenoma -2.686 0.003
inflammatory breast cancer -1.800 0.014
lung carcinoma -3.000 0.000
Pick disease -1.100 0.006
ductal carcinoma in situ -4.400 0.000
invasive ductal carcinoma -5.500 0.000
ovarian cancer -1.700 0.000
pituitary cancer -3.500 0.011

Synonym

Accession P02753 D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178
Symbols RDCCAS
MCOPCB10

Gene

PANTHER Protein Class (1)

PDB

1QAB   1RLB   2WQA   3BSZ   1BRP   1BRQ   1JYD   1JYJ   1RBP   2WQ9   2WR6   3FMZ   4O9S   4PSQ  

Gene RIF (239)

PMID Text
26962819 Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients.
26927700 RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls.
26731992 Elevated serum RBP4 level is one of the important risk factors for both carotid artery plaque formation and CHD in Chinese
26619134 male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots
26575118 RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction.
26526443 This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation.
26440092 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance
26425827 RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres.
26178727 Data suggest that RBP4 saturated with retinol, elevated carotenoids (hypercarotenemia), and elevated retinyl esters can be used as biological markers in serum of excessive stores of vitamin A in liver of preschool children with hypervitaminosis A.
26069091 Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio.
More...

AA Sequence

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ      1 - 70
MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL     71 - 140
LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL             141 - 201
//

Text Mined References (274)

PMID Year Title
26962819 2016 GC Gene Polymorphism and Unbound Serum Retinol-Binding Protein 4 Are Related to the Risk of Insulin Resistance in Patients With Chronic Hepatitis C: A Prospective Cross-Sectional Study.
26927700 2016 Retinoid and carotenoid status in serum and liver among patients at high-risk for liver cancer.
26731992 2015 Serum Retinol-Binding Protein-4 Level is a High Risk Factor for Coronary Heart Disease in Chinese.
26619134 2016 Male mice are susceptible to high fat diet-induced hyperglycaemia and display increased circulatory retinol binding protein 4 (RBP4) levels and its expression in visceral adipose depots.
26575118 2016 Retinol Binding Protein-4 and Adiponectin Levels in Thyroid Overt and Subclinical Dysfunction.
26526443 2016 Plasmatic retinol-binding protein 4 and glial fibrillary acidic protein as biomarkers to differentiate ischemic stroke and intracerebral hemorrhage.
26440092 2015 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance.
26425827 2016 Retinol binding protein and vitamin D associations with serum antibody isotypes, serum influenza virus-specific neutralizing activities and airway cytokine profiles.
26178727 2015 High provitamin A carotenoid serum concentrations, elevated retinyl esters, and saturated retinol-binding protein in Zambian preschool children are consistent with the presence of high liver vitamin A stores.
26069091 2016 Short-Term Regulation of Lipocalin-2 but not RBP-4 During Oral Lipid Tolerance Test and Oral Glucose Tolerance Test.
More...