Property Summary

NCBI Gene PubMed Count 272
PubMed Score 524.89
PubTator Score 1314.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
glioblastoma multiforme 347 2.9558336040901E-29
non-small cell lung cancer 2798 3.01940321495723E-18
lung carcinoma 2844 3.91991941579543E-14
ovarian cancer 8492 2.40131763347604E-9
malignant mesothelioma 3163 5.57245323750865E-8
lung adenocarcinoma 2714 1.32783219205387E-7
pilocytic astrocytoma 3086 4.10326587909111E-7
medulloblastoma 1524 4.04923900108428E-6
posterior fossa group B ependymoma 1530 1.35492880866211E-5
adrenocortical carcinoma 1427 2.14573695251174E-5
invasive ductal carcinoma 2950 8.63188749163055E-5
lung cancer 4473 1.01675646075321E-4
atypical teratoid / rhabdoid tumor 4369 1.10839797695102E-4
ductal carcinoma in situ 1745 1.92060535410266E-4
acute quadriplegic myopathy 1157 2.46754262001865E-4
interstitial cystitis 2299 3.87272436186814E-4
adrenocortical adenoma 134 4.35333143370206E-4
astrocytic glioma 2241 0.00109604109541289
breast carcinoma 1614 0.00131768864418396
adult high grade glioma 2148 0.00154596043440524
psoriasis 6685 0.00170899474467472
aldosterone-producing adenoma 664 0.00321525050682091
oligodendroglioma 2849 0.00370151826836203
Pick disease 1893 0.00554199471000414
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00666639721462249
Atopic dermatitis 944 0.00806585268139842
pituitary cancer 1972 0.0114016603012323
fibroadenoma 557 0.0130476190692177
primitive neuroectodermal tumor 3031 0.0131971004952443
non primary Sjogren syndrome sicca 840 0.0139743400941502
inflammatory breast cancer 404 0.0140536401538565
cystic fibrosis 1670 0.0193569230306772
sarcoidosis 368 0.027036280527698
active ulcerative colitis 477 0.0334982648741425
Disease Target Count Z-score Confidence
Microphthalmia 79 0.0 4.0

Expression

  Differential Expression (34)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
astrocytic glioma -3.600 0.001
oligodendroglioma -3.400 0.004
psoriasis 1.900 0.002
glioblastoma multiforme -3.000 0.000
posterior fossa group B ependymoma -2.700 0.000
medulloblastoma -3.600 0.000
cystic fibrosis 1.500 0.019
atypical teratoid / rhabdoid tumor -3.000 0.000
primitive neuroectodermal tumor -2.500 0.013
autosomal dominant Emery-Dreifuss muscul... 2.106 0.007
acute quadriplegic myopathy 1.545 0.000
Atopic dermatitis -2.300 0.008
adrenocortical adenoma -2.976 0.000
adrenocortical carcinoma -2.944 0.000
non-small cell lung cancer -2.285 0.000
lung cancer -1.800 0.000
active ulcerative colitis 1.720 0.033
sarcoidosis -1.900 0.027
breast carcinoma -3.300 0.001
fibroadenoma -4.000 0.013
interstitial cystitis -3.500 0.000
lung adenocarcinoma -2.000 0.000
adult high grade glioma -3.300 0.002
pilocytic astrocytoma -3.700 0.000
non primary Sjogren syndrome sicca 1.800 0.014
aldosterone-producing adenoma -2.686 0.003
inflammatory breast cancer -1.800 0.014
lung carcinoma -3.000 0.000
Pick disease -1.100 0.006
ductal carcinoma in situ -4.400 0.000
invasive ductal carcinoma -5.500 0.000
ovarian cancer -1.700 0.000
pituitary cancer -3.500 0.011

Synonym

Accession P02753 D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178
Symbols RDCCAS
MCOPCB10

Gene

PANTHER Protein Class (1)

PDB

1QAB   1RLB   2WQA   3BSZ   1BRP   1BRQ   1JYD   1JYJ   1RBP   2WQ9   2WR6   3FMZ   4O9S   4PSQ  

  Ortholog (12)

Gene RIF (239)

PMID Text
26962819 Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients.
26927700 RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls.
26731992 Elevated serum RBP4 level is one of the important risk factors for both carotid artery plaque formation and CHD in Chinese
26619134 male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots
26575118 RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction.
26526443 This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation.
26440092 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance
26425827 RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres.
26178727 Data suggest that RBP4 saturated with retinol, elevated carotenoids (hypercarotenemia), and elevated retinyl esters can be used as biological markers in serum of excessive stores of vitamin A in liver of preschool children with hypervitaminosis A.
26069091 Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio.
More...

AA Sequence

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ      1 - 70
MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL     71 - 140
LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL             141 - 201
//

Text Mined References (274)

PMID Year Title
26962819 2016 GC Gene Polymorphism and Unbound Serum Retinol-Binding Protein 4 Are Related to the Risk of Insulin Resistance in Patients With Chronic Hepatitis C: A Prospective Cross-Sectional Study.
26927700 2016 Retinoid and carotenoid status in serum and liver among patients at high-risk for liver cancer.
26731992 2015 Serum Retinol-Binding Protein-4 Level is a High Risk Factor for Coronary Heart Disease in Chinese.
26619134 2016 Male mice are susceptible to high fat diet-induced hyperglycaemia and display increased circulatory retinol binding protein 4 (RBP4) levels and its expression in visceral adipose depots.
26575118 2016 Retinol Binding Protein-4 and Adiponectin Levels in Thyroid Overt and Subclinical Dysfunction.
26526443 2016 Plasmatic retinol-binding protein 4 and glial fibrillary acidic protein as biomarkers to differentiate ischemic stroke and intracerebral hemorrhage.
26440092 2015 Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance.
26425827 2016 Retinol binding protein and vitamin D associations with serum antibody isotypes, serum influenza virus-specific neutralizing activities and airway cytokine profiles.
26178727 2015 High provitamin A carotenoid serum concentrations, elevated retinyl esters, and saturated retinol-binding protein in Zambian preschool children are consistent with the presence of high liver vitamin A stores.
26069091 2016 Short-Term Regulation of Lipocalin-2 but not RBP-4 During Oral Lipid Tolerance Test and Oral Glucose Tolerance Test.
More...