Property Summary

Ligand Count 120
NCBI Gene PubMed Count 290
PubMed Score 556.80
PubTator Score 1314.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Microphthalmia 76 0.0 4.0

Expression

  Differential Expression (34)

Disease log2 FC p
active ulcerative colitis 1.720 3.3e-02
acute quadriplegic myopathy 1.545 2.5e-04
adrenocortical adenoma -2.976 4.4e-04
adrenocortical carcinoma -2.944 2.1e-05
adult high grade glioma -3.300 1.5e-03
aldosterone-producing adenoma -2.686 3.2e-03
astrocytic glioma -3.600 1.1e-03
Astrocytoma, Pilocytic -3.700 3.3e-07
Atopic dermatitis -2.300 8.1e-03
atypical teratoid / rhabdoid tumor -3.000 1.1e-04
autosomal dominant Emery-Dreifuss muscul... 2.106 6.7e-03
breast carcinoma -3.300 1.3e-03
cystic fibrosis -1.195 2.0e-05
ductal carcinoma in situ -4.400 1.9e-04
ependymoma -2.600 2.4e-06
fibroadenoma -4.000 1.3e-02
glioblastoma -2.600 5.5e-05
group 3 medulloblastoma -2.900 2.9e-02
inflammatory breast cancer -1.800 1.4e-02
interstitial cystitis -3.500 3.9e-04
invasive ductal carcinoma -5.500 8.6e-05
lung adenocarcinoma -1.100 9.2e-05
lung cancer -1.500 3.0e-04
lung carcinoma -3.000 3.9e-14
malignant mesothelioma -2.600 5.6e-08
non primary Sjogren syndrome sicca 1.800 1.4e-02
non-small cell lung cancer -2.285 3.0e-18
oligodendroglioma -3.400 3.7e-03
ovarian cancer -1.700 2.4e-09
Pick disease -1.100 5.5e-03
pituitary cancer -3.500 1.1e-02
primitive neuroectodermal tumor -2.500 1.3e-02
psoriasis -1.600 2.8e-03
sarcoidosis -1.900 2.7e-02

Protein-protein Interaction (4)

Gene RIF (257)

AA Sequence

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ      1 - 70
MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL     71 - 140
LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL             141 - 201
//

Text Mined References (295)

PMID Year Title