Property Summary

NCBI Gene PubMed Count 532
Grant Count 74
R01 Count 36
Funding $19,884,184.35
PubMed Score 1121.26
PubTator Score 768.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (55)

Disease Z-score Confidence
Cancer 2,346 4.614 2.3
Animal Mammary Neoplasms 136
Aortic valve insufficiency 22
Atopic dermatitis 944
Becker muscular dystrophy 187
Breast cancer 3,094
Carcinoma 2,147 1.0
Crohn Disease 97
Duchenne muscular dystrophy 602
Focal glomerulosclerosis 22
GLOMERULOPATHY WITH FIBRONECTIN DEPOSITS... 1 
Gaucher disease type 1 171
Glomerulopathy with fibronectin deposits 1
Hydrolethalus syndrome 128
Hypertensive disease 193
Kidney cancer 118 1.0
Left Ventricular Hypertrophy 24
Mammary Neoplasms 410
Mammary Neoplasms, Experimental 150
Neoplasm Invasiveness 127
Neoplastic Cell Transformation 81
Polycystic Ovary Syndrome 332
Spontaneous abortion 108
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
cystic fibrosis 1,665
diabetes mellitus 1,663
ductal carcinoma in situ 1,745
ependymoma 2,514
gastric carcinoma 832
glioblastoma 5,572
interstitial lung disease 291
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
pterygium 74
sonic hedgehog group medulloblastoma 1,482
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Gene

FN1

PANTHER Protein Class (1)

PDB

2OCF   3EJH   3GXE   1E88   1E8B   1FBR   1FNA   1FNF   1FNH   1J8K   1O9A   1OWW   1Q38   1QGB   1QO6   1TTF   1TTG   2CG6   2CG7   2CK2   2CKU   2EC3   2FN2   2FNB   2GEE   2H41   2H45   2HA1   2N1K   2RKY   2RKZ   2RL0   3CAL   3M7P   3MQL   3R8Q   3T1W   3ZRZ   4GH7   4JE4   4JEG   4LXO   4MMX   4MMY   4MMZ   4PZ5   5DC0   5DC4   5DC9   5DFT   5J7C  

 GWAS Trait (1)

Gene RIF (374)

PMID Text
27023403 These results suggest novel functions of endogenous FN involved in immune evasion and maintenance of hepatitis b virus replication.
26773938 Pharmacophore-based screening targeted at upregulated FN1, MMP-9, APP reveals therapeutic compounds for nasopharyngeal carcinoma.
26691015 that strong FN1 promoter activity drives inappropriate expression of the biologically active portion of EGF
26654447 the correlation between placental DNAm of INHBA/FN1 and maternal serum INHA/FN1 levels indicate that DNAm may be a useful tool to identify novel biomarkers for adverse pregnancy outcomes in some cases.
26601950 Fibronectin binding to heparan sulfate mediates exosome-cell interactions in Myeloma.
26535688 polymorphisms in rs6725958, rs10202709, and rs35343655 of the Fn gene had no obvious effect on the susceptibility to the development of calcium oxalate stones in the Uighur population, residing in the Xinjiang region of China.
26517579 Study determined the structure of third type III domain, 3FN3 using nuclear magnetic resonance spectroscopy, and investigated its stability, folding, and unfolding.
26381135 The pathogenic H5N1 and H7N9 influenza virus variants cause more severe deregulation of NRF2 and fibronectin in host epithelial cells than the less pathogenic H1N1 variant.
26342086 Asthmatic human bronchial epithelial cells are intrinsically primed to produce more fibronectin, which when deposited into the extracellular matrix, is capable of driving remodeling and inflammation.
26341143 An observed increase in PLD activity was mediated through boosting the binding of PLD with dynamin which in turn facilitated fibronectin-induced cell spreading.
More...

AA Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYL      1 - 70
GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANR     71 - 140
CHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMM    141 - 210
VDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTS    211 - 280
SGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQT    281 - 350
YGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC    351 - 420
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDM    421 - 490
GHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQ    491 - 560
CQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQW    561 - 630
NAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTT    631 - 700
STSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPS    701 - 770
TATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG    771 - 840
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSP    841 - 910
RDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAV    911 - 980
SHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK    981 - 1050
YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVR   1051 - 1120
PSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGV   1121 - 1190
LTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS   1191 - 1260
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLP   1261 - 1330
GTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGR   1331 - 1400
PREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDA   1401 - 1470
PAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT   1471 - 1540
EIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVV   1541 - 1610
SVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP   1611 - 1680
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLT   1681 - 1750
GYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRA   1751 - 1820
RVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNA   1821 - 1890
RSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATI   1891 - 1960
TGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDT   1961 - 2030
GNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP   2031 - 2100
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNV   2101 - 2170
IVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGS   2171 - 2240
GHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK   2241 - 2310
EYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQAD   2311 - 2380
REDSRE                                                                   2381 - 2386
//

Text Mined References (555)

PMID Year Title
27023403 2016 Hepatitis B Virus Stimulated Fibronectin Facilitates Viral Maintenance and Replication through Two Distinct Mechanisms.
26773938 2016 Pharmacophore-based screening targeted at upregulated FN1, MMP-9, APP reveals therapeutic compounds for nasopharyngeal carcinoma.
26691015 2016 FN1-EGF gene fusions are recurrent in calcifying aponeurotic fibroma.
26654447 2015 Placental DNA methylation at term reflects maternal serum levels of INHA and FN1, but not PAPPA, early in pregnancy.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26601950 2016 Fibronectin on the Surface of Myeloma Cell-derived Exosomes Mediates Exosome-Cell Interactions.
26571399 2015 A collagen VI-dependent pathogenic mechanism for Hirschsprung's disease.
26535688 2015 Correlation between the development of calcium oxalate stones and polymorphisms in the fibronectin gene in the Uighur population of the Xinjiang region of China.
26517579 2015 Structure and unfolding of the third type III domain from human fibronectin.
26381135 2015 Highly Pathogenic H5N1 and Novel H7N9 Influenza A Viruses Induce More Profound Proteomic Host Responses than Seasonal and Pandemic H1N1 Strains.
More...