Property Summary

NCBI Gene PubMed Count 52
PubMed Score 135.25
PubTator Score 68.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma 1.700 3.8e-04
ductal carcinoma in situ 1.200 1.3e-02
head and neck cancer 1.600 1.0e-04
osteosarcoma -3.153 1.7e-06
pancreatic ductal adenocarcinoma liver m... -4.498 2.9e-04
psoriasis 2.000 5.3e-33
tuberculosis and treatment for 3 months -1.100 1.7e-02
ulcerative colitis 1.100 1.4e-03

Gene RIF (35)

AA Sequence

MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADT      1 - 70
VHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASA     71 - 140
TLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRG    141 - 210
PLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLW    211 - 280
ASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ       281 - 347
//

Text Mined References (56)

PMID Year Title