Property Summary

NCBI Gene PubMed Count 41
Grant Count 25
R01 Count 11
Funding $6,866,633.17
PubMed Score 124.19
PubTator Score 68.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.153 0.000
pancreatic ductal adenocarcinoma liver m... -4.498 0.000
tuberculosis and treatment for 3 months -1.100 0.017
breast carcinoma 1.700 0.000
psoriasis 2.200 0.000
ductal carcinoma in situ 1.200 0.013
ulcerative colitis 1.100 0.001
head and neck cancer 1.600 0.000

Gene RIF (26)

PMID Text
26856989 Results provided evidence for LRG1 function as a novel inducer of epithelial-mesenchymal transition and angiogenesis in colorectal cancer, which was at least partially through promotion of HIF-1alpha expression.
26517349 Data show that leucine-rich-alpha-2-glycoprotein 1 (LRG1) is markedly up-regulated and serves as an independent factor of poor outcomes in hepatocellular carcinoma (HCC).
26448929 Reanalysis of a total of 47 MDS patients revealed biomarker candidates, with alpha-2-HS-glycoprotein and leucine-rich alpha-2-glycoprotein as the most promising candidates.
26425690 Two of these proteins were verified in a separate patient cohort: values of CRP and LRG1 combined gave a highly significant indication of extended survival post one week of radiotherapy treatment.
26049667 Findings suggest that LRG1 promotes invasion and migration of glioma cells through TGF-beta signaling pathway.
25814288 LGR1 is involved in the inhibition of HCC metastasis.
25799488 Data found LRG1 as a promising candidate marker for detection of epithelial ovarian cancer (EOC) and the combination of LRG1 and CA125 showed improved performance to distinguish EOC including early stage EOC from non-cases compared to CA125.
25636050 Higher LRG1 is a significant predictor for arterial stiffness, endothelial function, and peripheral arterial disease.
25589464 silencing the expression of LRG1 suppresses the growth of glioblastoma U251 cells in vitro and in vivo, suggesting that LRG1 may play a critical role in glioblastoma development, and it may have potential clinical implications in glioblastoma therapy.
25277046 The blood proteins IGF1, IGF2, IBP2, IBP3 and A2GL have been proposed as indirect biomarkers for detection of GH administration and as putative biomarkers for breast cancer diagnosis.
More...

AA Sequence

MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADT      1 - 70
VHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASA     71 - 140
TLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRG    141 - 210
PLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLW    211 - 280
ASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ       281 - 347
//

Text Mined References (45)

PMID Year Title
26856989 2016 LRG1 modulates epithelial-mesenchymal transition and angiogenesis in colorectal cancer via HIF-1? activation.
26517349 2015 LRG1 expression indicates unfavorable clinical outcome in hepatocellular carcinoma.
26448929 2015 Plasma Protein Biomarker Candidates for Myelodysplastic Syndrome Subgroups.
26425690 2015 Discovery and Validation of Predictive Biomarkers of Survival for Non-small Cell Lung Cancer Patients Undergoing Radical Radiotherapy: Two Proteins With Predictive Value.
26049667 2015 LRG1 modulates invasion and migration of glioma cell lines through TGF-? signaling pathway.
25814288 2015 LRG1 suppresses the migration and invasion of hepatocellular carcinoma cells.
25799488 2015 Validation of LRG1 as a potential biomarker for detection of epithelial ovarian cancer by a blinded study.
25636050 2015 Elevation of a novel angiogenic factor, leucine-rich-?2-glycoprotein (LRG1), is associated with arterial stiffness, endothelial dysfunction, and peripheral arterial disease in patients with type 2 diabetes.
25589464 2015 Stable knockdown of LRG1 by RNA interference inhibits growth and promotes apoptosis of glioblastoma cells in vitro and in vivo.
25277046 2015 Targeted mass spectrometry analysis of the proteins IGF1, IGF2, IBP2, IBP3 and A2GL by blood protein precipitation.
More...