Property Summary

NCBI Gene PubMed Count 211
Grant Count 59
R01 Count 45
Funding $13,142,406
PubMed Score 1378.70
PubTator Score 1178.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02749 B2R9M3 Q9UCN7
Symbols BG
B2G1
B2GP1

Gene

PDB

2KRI   1C1Z   1G4F   1G4G   1QUB   3OP8   4JHS  

Gene RIF (175)

PMID Text
26900811 Prevalence and pathogenicity of IgA aB2GPI antibodies may vary from a population of ESRD patients to another.
26711810 We identified APOH as an obesity-resistance gene that interacts with FTO rs9939609 to more than double the occurrence of thinness.
26670100 The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes.
26261630 Trp316Ser variant (rs1801690) near the apolipoprotein H (beta2-glycoprotein-I) gene was associated with serum lipid parameters in Chinese volunteers. Suggest that there may be have racial/ethnic-and/or gender-specificity.
26045739 The renoprotective and antifibrosis effects of beta2GPI and reduced beta2GPI on diabetic nephropathy were closely associated with suppressing the activation of the TGF-beta1-p38 MAPK pathway.
25556540 Plasma apolipoprotein H limits HCV replication and associates with response to NS3 protease inhibitor-based therapy.
25405208 Data indicate that subjects with xidized low-density lipoprotein/beta2-glycoprotein I (oxLDL/beta2GPI) above the median (0.25 U/mL) were more likely to have arterial or venous disease.
25256745 Partial or complete removal of the carbohydrate chains uncover cryptic epitopes present in beta(2)GPI.
25081279 APOH is a new candidate gene associated with thrombosis
25071084 Pretransplant IgA-aB2GPI-ab may have a detrimental effect on early clinical outcomes after renal transplantation.
More...

AA Sequence

MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTG      1 - 70
LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI     71 - 140
ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSR    141 - 210
PDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERV    211 - 280
KIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC         281 - 345
//

Text Mined References (218)

PMID Year Title
27297331 2016 Association of anticardiolipin, antiphosphatidylserine, anti-?2 glycoprotein I, and antiphosphatidylcholine autoantibodies with canine immune thrombocytopenia.
26900811 2016 Prevalence of IgA Antibodies to ?2-Glycoprotein I: A Population-Dependent Feature?
26711810 2016 APOH interacts with FTO to predispose to healthy thinness.
26670100 2015 Impact of IL28B, APOH and ITPA Polymorphisms on Efficacy and Safety of TVR- or BOC-Based Triple Therapy in Treatment-Experienced HCV-1 Patients with Compensated Cirrhosis from the ANRS CO20-CUPIC Study.
26261630 2015 Association of the Trp316Ser variant (rs1801690) near the apolipoprotein H (?2-glycoprotein-I) gene and serum lipid levels.
26045739 2015 Reduced beta 2 glycoprotein I improves diabetic nephropathy via inhibiting TGF-?1-p38 MAPK pathway.
25556540 2015 Plasma apolipoprotein H limits HCV replication and associates with response to NS3 protease inhibitors-based therapy.
25405208 2014 Proatherogenic oxidized low-density lipoprotein/?2-glycoprotein I complexes in arterial and venous disease.
25256745 2014 The role of ?2-glycoprotein I (?2GPI) carbohydrate chains in the reactivity of anti-?2GPI antibodies from patients with primary antiphospholipid syndrome and in the activation and differentiation of U937 cells.
25081279 2014 Identification of APOH polymorphisms as common genetic risk factors for venous thrombosis in the Chinese population.
More...