Property Summary

NCBI Gene PubMed Count 219
PubMed Score 1422.82
PubTator Score 1178.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Protein-protein Interaction (1)

Gene RIF (180)

AA Sequence

MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTG      1 - 70
LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI     71 - 140
ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSR    141 - 210
PDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERV    211 - 280
KIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC         281 - 345
//

Text Mined References (226)

PMID Year Title