Property Summary

NCBI Gene PubMed Count 65
Grant Count 2
Funding $146,417
PubMed Score 71.03
PubTator Score 336.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.531 0.039
psoriasis 1.200 0.000

Synonym

Accession P02748
Symbols C9D
ARMD15

Gene

C9

 Grant Application (2)

PDB

5FMW  

Gene RIF (33)

PMID Text
26767664 Patients with advanced atrophic AMD carried these rare variants more frequently than patients with neovascular AMD (11 of 93 [11.8%] vs 40 of 835 [4.8%]; P = .04).
26404905 Serum-expressed apolipoprotein B-100 protein, C9 Complement, and gelsolin can be used for differential diagnosis of Barrertts esophagus and adenocarcinoma of esophagus.
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24719326 Data indicate that complement C9 binds to the ATPase domain of mortalin.
23943762 Borrelial CspA binds the human terminal complement components C7 and C9 and blocks assembly and membrane insertion of the terminal complement complex (TCC).
23487461 Liver biopsy specimens from chronically hepatitis C virus-infected patients exhibited a lower level of C9 mRNA expression than liver biopsy specimens from unrelated disease or healthy control human liver RNA.
22528500 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22190594 the haploinsufficiency of C9, a terminal complement complex component, engenders reduced intraocular secretion of VEGF and decreased risk for CNV development.
21840429 C9 and fucosylated form could serve as a useful marker for SQLC.
21507937 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
More...

AA Sequence

MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVF      1 - 70
GQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRP     71 - 140
PCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEK    141 - 210
NFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETY    211 - 280
QLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSG    281 - 350
SLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN    351 - 420
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLK    421 - 490
KQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK     491 - 559
//

Text Mined References (70)

PMID Year Title
26767664 2016 Rare Genetic Variants Associated With Development of Age-Related Macular Degeneration.
26404905 2015 Serum Glycoprotein Biomarker Discovery and Qualification Pipeline Reveals Novel Diagnostic Biomarker Candidates for Esophageal Adenocarcinoma.
25735751 2015 Exposure to the complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
24719326 2014 Mortalin/GRP75 binds to complement C9 and plays a role in resistance to complement-dependent cytotoxicity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036952 2013 Rare variants in CFI, C3 and C9 are associated with high risk of advanced age-related macular degeneration.
23943762 2013 CspA from Borrelia burgdorferi inhibits the terminal complement pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23487461 2013 Hepatitis C virus suppresses C9 complement synthesis and impairs membrane attack complex function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...