Property Summary

NCBI Gene PubMed Count 54
PubMed Score 41.25
PubTator Score 22.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02746 Q5T959 Q96H17
Symbols

Gene

PDB

1PK6   2JG8   2JG9   2WNU   2WNV   5HKJ   5HZF  

 OMIM Term (1)

Gene RIF (45)

PMID Text
25817358 no significant association found to either rs15940 (C1QA) or rs172378 (C1QC) when analysed in just Parkinson disease cases , just controls or combined
24739385 PepO facilitates C1q-mediated bacterial adherence, whereas its localized release consumes complement as a result of its activation following binding of C1q, thus representing an additional mechanism of human complement escape by this versatile pathogen.
23720782 Data indicate that Cna binds to C1q.
23650384 Analysis of its interaction properties by surface plasmon resonance shows that rC1q retains the ability of serum C1q to associate with the C1s-C1r-C1r-C1s tetramer, to recognize physiological C1q ligands such as IgG and pentraxin 3
23607884 Single nucleotide polymorphisms in and around the C1q genes, C1qA, C1qB and C1qC, correlated with C1q serum levels and may be a risk for the development of rheumatoid arthritis.
22740328 We identified a major linear epitope of C1q that is the target of anti-C1q in systemic lupus erythematosus.
21951915 The susceptibility for schizophrenia was particularly associated with C1QB rs291982 GG genotype.
21862594 analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages
21698244 a 2-gene signature consisting of PLEK2 and C1QB led to the best result that correctly classified 93.3% melanoma patients and 90% healthy controls
20528885 In a large family-based association study of C1Q gene cluster polymorphisms no evidence for a genetic role of C1Q locus SNP in systemic lupus erythematosus risk predisposition was obtained in patients of European ancestry.
More...

AA Sequence

MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGD      1 - 70
HGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTI     71 - 140
RFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTG    141 - 210
GMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA                               211 - 253
//

Text Mined References (57)

PMID Year Title
26410546 2015 Fundamental role of C1q in autoimmunity and inflammation.
26175731 2015 Emerging and Novel Functions of Complement Protein C1q.
25817358 2015 Variation in complement protein C1q is not a major contributor to cognitive impairment in Parkinson's disease.
24739385 2014 Binding of Streptococcus pneumoniae endopeptidase O (PepO) to complement component C1q modulates the complement attack and promotes host cell adherence.
23720782 2013 Collagen-binding microbial surface components recognizing adhesive matrix molecule (MSCRAMM) of Gram-positive bacteria inhibit complement activation via the classical pathway.
23650384 2013 Expression of recombinant human complement C1q allows identification of the C1r/C1s-binding sites.
23607884 2013 Genetic variants in the region of the C1q genes are associated with rheumatoid arthritis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22740328 2012 Identification of a major linear C1q epitope allows detection of systemic lupus erythematosus anti-C1q antibodies by a specific peptide-based enzyme-linked immunosorbent assay.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
More...