Property Summary

NCBI Gene PubMed Count 56
PubMed Score 42.51
PubTator Score 22.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 3.468 1.7
Disease Target Count
IGA Glomerulonephritis 50

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.201 9.3e-05
adrenocortical carcinoma -1.712 7.0e-03
astrocytic glioma 1.500 3.2e-02
Astrocytoma, Pilocytic 1.200 1.4e-04
chronic kidney disease 1.100 4.8e-02
cutaneous lupus erythematosus 3.600 4.9e-05
dermatomyositis 1.700 1.9e-02
Down syndrome 1.600 3.7e-02
esophageal adenocarcinoma 1.700 1.9e-02
glioblastoma 3.700 1.7e-05
group 3 medulloblastoma -1.300 8.5e-03
head and neck cancer and chronic obstruc... 1.500 7.6e-03
interstitial cystitis 2.100 2.6e-03
intraductal papillary-mucinous adenoma (... -1.700 2.0e-02
invasive ductal carcinoma 2.565 2.3e-04
juvenile dermatomyositis 2.189 6.3e-08
limb girdle muscular dystrophy 2A 1.345 2.6e-08
lung adenocarcinoma -1.100 7.5e-03
lung cancer -1.600 1.2e-04
lung carcinoma -2.500 2.6e-26
medulloblastoma, large-cell -2.000 2.0e-04
nasopharyngeal carcinoma 1.500 7.1e-04
non-small cell lung cancer -1.877 3.0e-14
ovarian cancer -2.900 9.8e-05
primary Sjogren syndrome 1.200 2.6e-03
psoriasis 1.100 4.1e-13
subependymal giant cell astrocytoma 2.605 1.4e-02
tuberculosis 2.100 5.4e-04
ulcerative colitis 1.400 3.7e-03

 OMIM Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (41)

AA Sequence

MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGD      1 - 70
HGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTI     71 - 140
RFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTG    141 - 210
GMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA                               211 - 253
//

Text Mined References (59)

PMID Year Title