Property Summary

NCBI Gene PubMed Count 110
Grant Count 15
R01 Count 12
Funding $2,072,194.29
PubMed Score 50.26
PubTator Score 2440.86

Knowledge Summary

Patent

No data available

Expression

 OMIM Term (1)

Gene RIF (98)

PMID Text
26831747 These findings support a role for locally synthesized C1q in promoting tumor growth.
26829984 anti-C1q induced a proinflammatory phenotype in human monocyte-derived macrophages reversing the effects of immobilized C1q alone
26563161 decreased levels result in predominant skin manifestations in children
26095468 The A allele and AA genotype of C1q rs292001 can be considered a susceptibility risk factor and the GG genotype could be considered protective for juvenile systemic lupus erythematosus and lupus nephritis in the studied cohort of Egyptian children.
25817358 no significant association found to either rs15940 (C1QA) or rs172378 (C1QC) when analysed in just Parkinson disease cases , just controls or combined
25491308 Elevation in serum C1q levels are associated with sarcopenia.
25487697 This study reveled that C1QA having a central role in the bipolar disease and schizophrenia manifestation.
25184227 Our findings showed that Brugia malayi Calreticulin (BmCRT) is responsible for the prevention of classical complement pathway activation via its interaction with the first component C1q of the human host
24747831 A newly characterized leech calreticulin (HmCalR) has been shown to interact with C1q and participate to the HmC1q-dependent microglia accumulation.
24739385 PepO facilitates C1q-mediated bacterial adherence, whereas its localized release consumes complement as a result of its activation following binding of C1q, thus representing an additional mechanism of human complement escape by this versatile pathogen.
More...

AA Sequence

MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQ      1 - 70
GEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQ     71 - 140
EEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQ    141 - 210
QGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA                                       211 - 245
//

Text Mined References (112)

PMID Year Title
27648858 2016 The production and secretion of complement component C1q by human mast cells.
27333900 2016 Complement is activated in progressive multiple sclerosis cortical grey matter lesions.
27267200 2016 Transcriptome analysis of human brain tissue identifies reduced expression of complement complex C1Q Genes in Rett syndrome.
26831747 2016 C1q acts in the tumour microenvironment as a cancer-promoting factor independently of complement activation.
26829984 2016 Anti-C1q Autoantibodies from Systemic Lupus Erythematosus Patients Induce a Proinflammatory Phenotype in Macrophages.
26563161 2015 Early Complement Component Deficiency in a Single-Centre Cohort of Pediatric Onset Lupus.
26410546 2015 Fundamental role of C1q in autoimmunity and inflammation.
26175731 2015 Emerging and Novel Functions of Complement Protein C1q.
26095468 2015 C1q rs292001 polymorphism and C1q antibodies in juvenile lupus and their relation to lupus nephritis.
25817358 2015 Variation in complement protein C1q is not a major contributor to cognitive impairment in Parkinson's disease.
More...