Property Summary

NCBI Gene PubMed Count 120
PubMed Score 51.17
PubTator Score 2440.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lupus erythematosus 57 3.997 2.0

Expression

 OMIM Phenotype (1)

Gene RIF (98)

AA Sequence

MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQ      1 - 70
GEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQ     71 - 140
EEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQ    141 - 210
QGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA                                       211 - 245
//

Text Mined References (122)

PMID Year Title