Property Summary

NCBI Gene PubMed Count 95
PubMed Score 461.31
PubTator Score 511.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (54)

AA Sequence

MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFS      1 - 70
YNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQ     71 - 140
GYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYE    141 - 210
IRGYVIIKPLVWV                                                             211 - 223
//

Text Mined References (99)

PMID Year Title