Property Summary

NCBI Gene PubMed Count 87
Grant Count 60
R01 Count 17
Funding $6,678,570.26
PubMed Score 450.93
PubTator Score 511.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02743 SAP
Symbols SAP
PTX2
HEL-S-92n

Gene

PDB

1GYK   1LGN   1SAC   2A3W   2A3X   2A3Y   2W08   3D5O   3KQR   4AVS   4AVT   4AVV   4AYU  

Gene RIF (50)

PMID Text
26106150 Data suggest that serum amyloid P (SAP) activates CD209 DC-SIGN to regulate the innate immune system differently from C-reactive protein (CRP), and that DC-SIGN is a target for antifibrotics.
25084341 Here, it is reported that X-ray analysis of the SAP complex with CPHPC and cadmium ions provides higher resolution detail of the interaction than is observed with calcium ions.
25024390 plasma protein serum amyloid P binds to FcgammaRI on monocytes to inhibit fibrocyte differentiation, and binds to FcgammaRIIa on neutrophils to reduce neutrophil adhesion.
24933153 The effects of SAP and Xiapex (Collagenase Clostridium histolyticum) on fibrocytes derived from Dupuytren's disease, was evaluated.
24695531 Compared to wildtype C57BL/6 mice, we find that in Apcs-/- "SAP knock-out" mice, bleomycin induces a more persistent inflammatory response and increased fibrosis.
23992930 In the late phase post-myocardial infarct there is a coordinated decrease in immune response-inflammation proteins, except for SAP which showed an increase related to the specific activation of the classical complement pathway.
23966633 These results indicate that SAP functions as a host defense factor, similar to other peptidoglycan recognition proteins and nucleotide-binding oligomerization domain-like receptors.
23600950 Human SAP binds phosphoethanolamine, while rabbits seem to have low levels of SAP that bind to a lesser extent.
23544079 SAP may act as an effective receptor mimic to limit influenza A virus infection of airway epithelial cells.
23527487 [review] On the basis of structure, serum amyloid P component is a prototype of the short pentraxin family.
More...

AA Sequence

MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFS      1 - 70
YNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQ     71 - 140
GYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYE    141 - 210
IRGYVIIKPLVWV                                                             211 - 223
//

Text Mined References (91)

PMID Year Title
26106150 2015 DC-SIGN activation mediates the differential effects of SAP and CRP on the innate immune system and inhibits fibrosis in mice.
25084341 2014 Interaction of serum amyloid P component with hexanoyl bis(D-proline) (CPHPC).
25024390 2014 Distinct Fc? receptors mediate the effect of serum amyloid p on neutrophil adhesion and fibrocyte differentiation.
24933153 2014 First identification of resident and circulating fibrocytes in Dupuytren's disease shown to be inhibited by serum amyloid P and Xiapex.
24695531 2014 Persistent lung inflammation and fibrosis in serum amyloid P component (APCs-/-) knockout mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23992930 2013 Coordinated proteomic signature changes in immune response and complement proteins in acute myocardial infarction: the implication of serum amyloid P-component.
23966633 2013 Human SAP is a novel peptidoglycan recognition protein that induces complement-independent phagocytosis of Staphylococcus aureus.
23600950 2013 CRP and SAP from different species have different membrane ligand specificities.
23544079 2013 Serum amyloid P is a sialylated glycoprotein inhibitor of influenza A viruses.
More...