Property Summary

NCBI Gene PubMed Count 1,887
PubMed Score 36497.61
PubTator Score 27912.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
lung cancer 4740 0.0 0.9
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 7.004 3.5
Kidney disease 430 6.339 3.2
Cerebrovascular disease 238 6.23 3.1
Pneumonia 174 6.182 3.1
Appendicitis 15 6.127 3.1
Heart disease 306 6.125 3.1
Crohn's disease 321 6.044 3.0
Ankylosing spondylitis 140 5.965 3.0
Anemia 365 5.765 2.9
Lipid metabolism disorder 114 5.676 2.8
Vasculitis 80 5.676 2.8
Cancer 2499 5.518 2.8
ulcerative colitis 1819 5.469 2.7
Osteomyelitis 42 5.435 2.7
Septic arthritis 8 5.384 2.7
Hypersensitivity reaction type II disease 253 5.345 2.7
Pancreatitis 123 5.305 2.7
Chronic obstructive pulmonary disease 184 5.285 2.6
Kawasaki disease 28 5.134 2.6
Obstructive sleep apnea 26 5.117 2.6
Acute cystitis 35 5.023 2.5
Synovitis 78 4.987 2.5
tuberculosis 2010 4.949 2.5
Arthropathy 43 4.912 2.5
Leukopenia 72 4.84 2.4
Psoriatic arthritis 86 4.804 2.4
Epidural abscess 2 4.803 2.4
Osteoarthritis 184 4.732 2.4
Polycystic ovary syndrome 360 4.719 2.4
Peripheral artery disease 10 4.671 2.3
Peritonitis 43 4.618 2.3
Takayasu's arteritis 53 4.572 2.3
Collagen disease 27 4.516 2.3
Diarrhea 253 4.515 2.3
Liver disease 237 4.474 2.2
Exanthem 37 4.468 2.2
Fatty liver disease 103 4.435 2.2
Chorioamnionitis 14 4.425 2.2
Thrombocytosis 38 4.392 2.2
Hyperglycemia 137 4.365 2.2
Diverticulitis 11 4.364 2.2
Myopathy 185 4.348 2.2
Pyuria 5 4.327 2.2
Cholecystitis 18 4.182 2.1
adult-onset Still's disease 8 4.164 2.1
Respiratory Failure 104 4.106 2.1
Peripheral vascular disease 87 4.082 2.0
Thrombocytopenia 197 4.021 2.0
Aortic aneurysm 38 4.019 2.0
Aortitis 4 4.009 2.0
Rheumatic fever 19 4.007 2.0
Cellulitis 20 3.957 2.0
Influenza 142 3.955 2.0
Pericarditis 13 3.928 2.0
Human immunodeficiency virus infectious disease 138 3.905 2.0
Hyperhomocysteinemia 37 3.869 1.9
Tonsillitis 16 3.846 1.9
Pelvic inflammatory disease 21 3.843 1.9
Hyperuricemia 49 3.821 1.9
Bacteriuria 8 3.796 1.9
Brucellosis 24 3.791 1.9
Mediastinitis 7 3.77 1.9
Hypothyroidism 122 3.721 1.9
Transient Cerebral Ischemia 25 3.707 1.9
Asthma 385 3.702 1.9
Bronchitis 43 3.701 1.9
Amyloidosis 67 3.66 1.8
Intestinal Obstruction 31 3.647 1.8
Gout 106 3.635 1.8
Pleural empyema 12 3.631 1.8
Osteoporosis 363 3.612 1.8
Pulmonary embolism 55 3.606 1.8
Dementia 175 3.605 1.8
Pharyngitis 17 3.598 1.8
Reactive arthritis 7 3.569 1.8
Uveitis 103 3.544 1.8
Pericardial effusion 14 3.533 1.8
interstitial lung disease 298 3.532 1.8
Intermittent claudication 20 3.511 1.8
Perinatal necrotizing enterocolitis 21 3.495 1.7
Limb ischemia 15 3.479 1.7
cystic fibrosis 1696 3.472 1.7
Urticaria 67 3.47 1.7
Brain disease 96 3.462 1.7
Thrombophilia 38 3.417 1.7
Gastroenteritis 41 3.387 1.7
Necrotizing fasciitis 10 3.375 1.7
Neuropathy 261 3.344 1.7
protein-energy malnutrition 8 3.335 1.7
Bronchiectasis 64 3.302 1.7
Orbital cellulitis 4 3.27 1.6
Hyperinsulinism 133 3.252 1.6
Chlamydia 21 3.207 1.6
Vesicoureteral reflux 32 3.204 1.6
Cervical adenitis 1 3.185 1.6
Neurodegenerative disease 414 3.157 1.6
Funisitis 7 3.152 1.6
Bronchiolitis 18 3.115 1.6
Bilirubin metabolic disorder 41 3.102 1.6
Henoch-Schoenlein purpura 12 3.102 1.6
Hyperandrogenism 34 3.091 1.5
Sinusitis 65 3.09 1.5
Acute cholangitis 1 3.086 1.5
Pain agnosia 104 3.077 1.5
Age related macular degeneration 72 3.065 1.5
Subdural empyema 7 3.05 1.5
Epididymitis 8 3.047 1.5
Bipolar Disorder 666 3.025 1.5
Hypereosinophilic syndrome 71 3.024 1.5
Hemophagocytic lymphohistiocytosis 30 3.01 1.5

Expression

  Differential Expression (2)

Gene RIF (1940)

AA Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIF      1 - 70
SYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLK     71 - 140
KGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKY    141 - 210
EVQGEVFTKPQLWP                                                            211 - 224
//

Text Mined References (1888)

PMID Year Title