Property Summary

NCBI Gene PubMed Count 269
PubMed Score 1628.12
PubTator Score 1046.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
osteosarcoma 7950 1.9e-05
psoriasis 6694 3.6e-04
mucosa-associated lymphoid tissue lymphoma 484 6.4e-03
tuberculosis 2010 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 4.441 6.4e-03
osteosarcoma -4.980 1.9e-05
psoriasis 1.200 3.6e-04
tuberculosis 1.900 2.2e-02

PDB (13)

Gene RIF (179)

AA Sequence

MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKN      1 - 70
QELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFI     71 - 140
FEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEG    141 - 210
HSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQ    211 - 280
LGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS    281 - 350
PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPA    351 - 420
ITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGR    421 - 490
VWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMV    491 - 560
PKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQ    561 - 630
KLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGS    631 - 700
GFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLV    701 - 770
GLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQ    771 - 840
IICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEGRDEYDEVAMP    841 - 910
V//

Text Mined References (278)

PMID Year Title