Property Summary

NCBI Gene PubMed Count 253
Grant Count 44
R01 Count 30
Funding $3,411,122.93
PubMed Score 1271.75
PubTator Score 1046.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.000
osteosarcoma -5.437 0.000
tuberculosis 1.900 0.022
mucosa-associated lymphoid tissue lympho... 4.441 0.006

 GWAS Trait (1)

Gene RIF (164)

PMID Text
26542571 this study reports the crystal structure of the band 3 anion exchanger domain (AE1(CTD)) at 3.5 angstroms.
26047685 The evolutionary origin of Southeast Asian Ovalocytosis, characterizing DNA sequence variation around the causal mutation in the SLC4A1 gene.
25957428 This study is considered as a pilot study showing the importance of AE1 mutations in Iranian children with DRTA.
25628009 The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin.
25616663 Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G.
25388786 Partial pyruvate kinase deficiency aggravates the phenotypic expression of band 3 deficiency in a family with hereditary spherocytosis.
25344524 Deficiency in Band 3 is associated with Hereditary Spherocytosis.
25257781 Results indicate that Tryptophan residues play differential roles in AE1 expression and function depending on their location in the protein and that Trp mutants with low expression are misfolded and retained in the endoplasmic reticulum.
25012180 Activities of AE1 and the sodium pump are coregulated in kidney.
24964668 In 12% of our thalassemia major patients, we found two bands in the agarose gel-electrophoresis of PCR products from band 3 gene with a difference of 65 +/- 10 bp, equivalent to a deletion of 20 to 25 amino acids in band 3 protein.
More...

AA Sequence

MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKN      1 - 70
QELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFI     71 - 140
FEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEG    141 - 210
HSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQ    211 - 280
LGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS    281 - 350
PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPA    351 - 420
ITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGR    421 - 490
VWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMV    491 - 560
PKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQ    561 - 630
KLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGS    631 - 700
GFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLV    701 - 770
GLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQ    771 - 840
IICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEGRDEYDEVAMP    841 - 910
V//

Text Mined References (262)

PMID Year Title
26823170 2016 Host-parasite interaction: multiple sites in the Plasmodium vivax tryptophan-rich antigen PvTRAg38 interact with the erythrocyte receptor band 3.
26542571 2015 Crystal structure of the anion exchanger domain of human erythrocyte band 3.
26049106 2015 Transmembrane protein 139 (TMEM139) interacts with human kidney isoform of anion exchanger 1 (kAE1).
26047685 2015 The evolutionary origins of Southeast Asian Ovalocytosis.
25957428 2015 A novel mutation pattern of kidney anion exchanger 1 gene in patients with distal renal tubular acidosis in Iran.
25628009 2015 The apicomplexan parasite Babesia divergens internalizes band 3, glycophorin A and spectrin during invasion of human red blood cells.
25616663 2015 Evidence of a structural and functional ammonium transporter RhBG·anion exchanger 1·ankyrin-G complex in kidney epithelial cells.
25388786 2015 Partial pyruvate kinase deficiency aggravates the phenotypic expression of band 3 deficiency in a family with hereditary spherocytosis.
25344524 2015 The cytoskeletal binding domain of band 3 is required for multiprotein complex formation and retention during erythropoiesis.
25257781 Differential roles of tryptophan residues in the functional expression of human anion exchanger 1 (AE1, Band 3, SLC4A1).
More...