Property Summary

NCBI Gene PubMed Count 89
PubMed Score 1166.70
PubTator Score 343.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 5.643 5.3e-03
osteosarcoma -7.274 6.7e-09
sarcoidosis 1.200 2.0e-02

Gene RIF (46)

AA Sequence

MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTV      1 - 70
YPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSV     71 - 140
EIENPETSDQ                                                                141 - 150
//

Text Mined References (107)

PMID Year Title