Property Summary

NCBI Gene PubMed Count 85
Grant Count 125
R01 Count 55
Funding $20,969,044.87
PubMed Score 1160.75
PubTator Score 343.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -7.274 0.000
mucosa-associated lymphoid tissue lympho... 5.643 0.005
sarcoidosis 1.200 0.020

Synonym

Accession P02724 A8K3E6 B8Q182 B8Q185 Q9BS51
Symbols MN
GPA
MNS
GPSAT
PAS-2
CD235a
GPErik
HGpMiV
HGpMiXI
HGpSta(C)

Gene

PDB

1AFO   1MSR   2KPE   2KPF   5EH4   5EH6  

Gene RIF (42)

PMID Text
26239059 Glycophorin-A-rich microparticles are released from evolving growing thrombi into the distal perfusing blood, and can be measured in peripheral blood. CD235a(+) cMPs may constitute a novel systemic biomarker of ongoing thrombosis.
25778531 GPA-deficient band 3 null erythrocytes are resistant to malaria infection.
25628009 The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of glycophorin A (GYPA, CD235a)
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of glycophorin A (GYPA, CD235a)
25205096 PfEBA-175 engages multiple glycans of GpA encoded by exon 3 and that the presentation of glycans is likely required for high-avidity binding.
24858913 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24043627 These data demonstrate the importance of PfEBA175 regions other than the DBL domains in the interaction with GYPA and merit their inclusion in an EBA175-based vaccine.
23722820 The expression of glycophorin A and osteoprotegerin is locally increased in carotid atherosclerotic lesions of symptomatic compared to asymptomatic patients.
21455273 Data suggest that glycophorin A (Gpa) increases expression and activity of Cl-/HCO3- exchanger Ae1, that G719D mutation renders Ae1 mutant constructs GPA-unresponsive, and suggests a role for Ae1 amino acids 22-28 in GPA responsiveness.
More...

AA Sequence

MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTV      1 - 70
YPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSV     71 - 140
EIENPETSDQ                                                                141 - 150
//

Text Mined References (103)

PMID Year Title
26239059 2015 Growing thrombi release increased levels of CD235a(+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients.
25778531 2015 Merozoite surface protein 1 recognition of host glycophorin A mediates malaria parasite invasion of red blood cells.
25628009 2015 The apicomplexan parasite Babesia divergens internalizes band 3, glycophorin A and spectrin during invasion of human red blood cells.
25205096 2014 Critical glycosylated residues in exon three of erythrocyte glycophorin A engage Plasmodium falciparum EBA-175 and define receptor specificity.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
24858913 2014 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043627 2013 Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.
More...