Property Summary

NCBI Gene PubMed Count 21
PubMed Score 138.42
PubTator Score 38.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 1.5e-02
astrocytic glioma 2.400 1.1e-03
Astrocytoma, Pilocytic 1.600 1.9e-06
atypical teratoid / rhabdoid tumor -4.600 1.5e-04
ependymoma -2.400 1.8e-03
group 3 medulloblastoma -4.000 1.4e-05
interstitial cystitis 1.300 2.4e-02
lung carcinoma 1.100 1.0e-07
medulloblastoma, large-cell -4.500 2.6e-06
oligodendroglioma 1.800 7.0e-03
Pick disease 1.100 1.5e-02
progressive supranuclear palsy -1.300 3.9e-02
psoriasis -1.700 3.4e-04

Gene RIF (5)

AA Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE      1 - 70
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV             71 - 132
//

Text Mined References (23)

PMID Year Title