Property Summary

NCBI Gene PubMed Count 19
PubMed Score 133.52
PubTator Score 38.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 3.40445936754261E-9
lung carcinoma 2844 9.99272286147167E-8
pilocytic astrocytoma 3086 1.41131671487238E-7
atypical teratoid/rhabdoid tumor 1095 1.5487326893487E-6
medulloblastoma, large-cell 6234 2.56914480388827E-6
adult high grade glioma 2148 1.32136789072932E-4
posterior fossa group A ependymoma 1511 1.56917512147162E-4
psoriasis 6685 3.36367712909834E-4
astrocytic glioma 2241 8.48987447242545E-4
oligodendroglioma 2849 0.00177602600459235
Pick disease 1893 0.0145883179941166
progressive supranuclear palsy 674 0.0203259157665876
interstitial cystitis 2299 0.0238330147718627
Disease Target Count Z-score Confidence
Neuritis 6 5.913 3.0
Microsporidiosis 12 5.603 2.8
Guillain-Barre syndrome 15 3.9 1.9

Expression

  Differential Expression (13)

Synonym

Accession P02689 Q6FHL4
Symbols P2
MP2
FABP8
M-FABP

Gene

PDB

2WUT   3NR3   4A1H   4A1Y   4A8Z   4BVM   4D6A   4D6B  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
26828946 This report might expand the genetic and clinical features of Charcot-Marie-Tooth disease and a further mechanism study will enhance our understanding of PMP2-associated peripheral neuropathy.
26527266 A fully deuterated sample of myelin P2 protein was produced identifying the neutron crystal structure.
24419389 The structure of human P2 refined at the ultrahigh resolution of 0.93 A allows detailed structural analyses, including the full organization of an internal hydrogen-bonding network.
20421974 the structure and function of the P2 protein from human myelin, which is able to bind both monomeric lipids inside its cavity and membrane surfaces

AA Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE      1 - 70
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV             71 - 132
//

Text Mined References (21)

PMID Year Title
26828946 2016 A Mutation in PMP2 Causes Dominant Demyelinating Charcot-Marie-Tooth Neuropathy.
26527266 2015 Production, crystallization and neutron diffraction of fully deuterated human myelin peripheral membrane protein P2.
25416956 2014 A proteome-scale map of the human interactome network.
24419389 2014 Atomic resolution view into the structure-function relationships of the human myelin peripheral membrane protein P2.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20421974 2010 Structural and functional characterization of human peripheral nervous system myelin protein P2.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
More...