Property Summary

NCBI Gene PubMed Count 138
PubMed Score 5256.96
PubTator Score 3588.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ependymoma 2514 2.18912133866508E-21
atypical teratoid/rhabdoid tumor 1095 6.1572622298006E-11
group 3 medulloblastoma 2254 2.78077528104677E-8
pilocytic astrocytoma 3086 4.97441244290017E-8
Breast cancer 3099 1.83874529422489E-7
ovarian cancer 8492 2.20544622306354E-7
malignant mesothelioma 3163 3.54940166776746E-7
pediatric high grade glioma 2712 4.02921092846506E-6
oligodendroglioma 2849 8.34501960862887E-6
Duchenne muscular dystrophy 602 8.46483153240983E-6
lung cancer 4473 1.46604956284009E-5
osteosarcoma 7933 1.6631759653391E-5
acute quadriplegic myopathy 1157 3.83910707013908E-5
medulloblastoma, large-cell 6234 5.695319719182E-5
Pick disease 1893 5.75203025640978E-5
astrocytoma 1493 1.16612164563527E-4
dermatomyositis 967 8.05950703481662E-4
glioblastoma 5572 0.00114432068959734
subependymal giant cell astrocytoma 2287 0.00199963090427856
psoriasis 6685 0.00274993458189936
primitive neuroectodermal tumor 3031 0.00275715100714556
progressive supranuclear palsy 674 0.00779497309694702
invasive ductal carcinoma 2950 0.00909582716980806
Down syndrome 548 0.00957538069552531
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0102726011721862
cutaneous lupus erythematosus 1056 0.0271363921743853
Rheumatoid Arthritis 1171 0.0312066288154262
Disease Target Count Z-score Confidence
Eye disease 55 0.0 2.0
Disease Target Count Z-score Confidence
Autoimmune disease of central nervous system 1 0.0 4.0

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.031
malignant mesothelioma -2.500 0.000
ependymoma -5.400 0.000
psoriasis -1.700 0.003
cutaneous lupus erythematosus -1.300 0.027
astrocytoma -1.300 0.000
glioblastoma -3.600 0.001
oligodendroglioma -1.800 0.000
osteosarcoma -3.119 0.000
group 3 medulloblastoma -7.000 0.000
atypical teratoid/rhabdoid tumor -5.500 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -4.600 0.003
Duchenne muscular dystrophy -1.009 0.000
acute quadriplegic myopathy -1.338 0.000
pancreatic ductal adenocarcinoma liver m... 1.817 0.010
lung cancer -3.800 0.000
pediatric high grade glioma -3.900 0.000
pilocytic astrocytoma -4.300 0.000
subependymal giant cell astrocytoma -6.953 0.002
Pick disease -2.200 0.000
progressive supranuclear palsy -2.100 0.008
Breast cancer -1.800 0.000
invasive ductal carcinoma -1.100 0.009
ovarian cancer -2.600 0.000
Down syndrome 1.500 0.010
dermatomyositis 1.800 0.001

Gene

MBP

PANTHER Protein Class (2)

PDB

1BX2   1FV1   1HQR   1K2D   1QCL   1YMM   1ZGL  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (74)

PMID Text
26781085 IL-17- and IL-22-secreting myelin specific CD4(+) T cells resistant to corticoids are associated with radiological activity of multiple sclerosis in early stages of the disease, mainly among Afrodescendant patients who, normally, have worse prognosis.
26756931 B cells from relapsing-remitting multiple sclerosis patients produce TNFa and IL6, and present MBP85-99 peptide
26526848 myelin basic protein has a role in activating CD4+ and CD8+ T lymphocytes in multiple sclerosis
26518750 Studies indicate that all myelin basic protein (MBP) isoforms are intrinsically disordered proteins (IDPs) that interact via molecular recognition fragments (MoRFs), which thereby undergo local disorder-to-order transitions.
26476704 This study observed a significantly increased myelin basic protein (MBP) and nuclear distribution protein nudE-like 1 (NDEL1) mRNA levels in FEP patients compared with controls.
25738751 Reduced myelin basic protein-induced CD4+ T-cell autoreactivity in interferon-beta-treated multiple sclerosis patients may be mediated by monocyte-derived interleukin-10
25276831 Negatively charged actin and calmodulin (CaM), as well as basic histone H1.3, inhibit MBP hydrolysis by competing with the proteasome and MBP, respectively, for binding their counterpart.
24739384 data reveal the first case of a pathophysiologically important autoantigen as a ubiquitin-independent substrate of the 26S proteasome.
24667176 Single nucleotide polymorphisms on genetic loci SOD2, MBP and C8orf42were not found significantly associated with advanced age-related macular degeneration in a Chinese cohort
23726766 In autistic children with allergic manifestations there were increased serum levels of MBP (and MAG) compared to those without allergies.
More...

AA Sequence

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT      1 - 70
ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP     71 - 140
SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKS    141 - 210
HGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDA    211 - 280
QGTLSKIFKLGGRDSRSGSPMARR                                                  281 - 304
//

Text Mined References (151)

PMID Year Title
26781085 2016 Interleukin-17- and interleukin-22-secreting myelin-specific CD4(+) T cells resistant to corticoids are related with active brain lesions in multiple sclerosis patients.
26756931 2016 Myelin Basic Protein-Induced Production of Tumor Necrosis Factor-? and Interleukin-6, and Presentation of the Immunodominant Peptide MBP85-99 by B Cells from Patients with Relapsing-Remitting Multiple Sclerosis.
26526848 2015 Early activation of CD4+ and CD8+ T lymphocytes by myelin basic protein in subjects with MS.
26518750 2015 MyelStones: the executive roles of myelin basic protein in myelin assembly and destabilization in multiple sclerosis.
26476704 2015 Increased expression of NDEL1 and MBP genes in the peripheral blood of antipsychotic-naïve patients with first-episode psychosis.
25738751 2015 Endogenous interferon-?-inducible gene expression and interferon-?-treatment are associated with reduced T cell responses to myelin basic protein in multiple sclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25276831 2014 Glatiramer acetate and nanny proteins restrict access of the multiple sclerosis autoantigen myelin basic protein to the 26S proteasome.
24739384 2014 Multiple sclerosis autoantigen myelin basic protein escapes control by ubiquitination during proteasomal degradation.
24667176 2014 Association study of newly identified age-related macular degeneration susceptible loci SOD2, MBP, and C8orf42 in Han Chinese population.
More...