Property Summary

NCBI Gene PubMed Count 145
PubMed Score 5367.43
PubTator Score 3588.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Eye disease 62 0.0 2.1
Heart conduction disease 83 0.0 0.7
Disease Target Count Z-score Confidence
Autoimmune disease of central nervous system 1 0.0 4.0

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy -1.338 3.8e-05
adult high grade glioma -2.700 2.6e-03
astrocytoma -1.300 1.2e-04
Astrocytoma, Pilocytic -3.600 3.1e-07
atypical teratoid / rhabdoid tumor -3.500 1.8e-06
Breast cancer -1.800 1.8e-07
cutaneous lupus erythematosus -1.300 2.7e-02
dermatomyositis 1.800 8.1e-04
Down syndrome 1.500 9.6e-03
Duchenne muscular dystrophy -1.009 8.5e-06
ependymoma -1.500 5.1e-03
glioblastoma -2.600 2.0e-04
group 3 medulloblastoma -5.200 1.0e-05
invasive ductal carcinoma -1.100 9.1e-03
lung cancer -2.200 3.7e-04
malignant mesothelioma -2.500 3.5e-07
medulloblastoma, large-cell -3.100 5.1e-04
oligodendroglioma -1.100 1.3e-07
osteosarcoma -2.166 9.7e-03
ovarian cancer -2.600 2.2e-07
pancreatic ductal adenocarcinoma liver m... 1.817 1.0e-02
Pick disease -2.200 5.8e-05
primitive neuroectodermal tumor -3.200 4.0e-03
progressive supranuclear palsy -2.100 7.8e-03
psoriasis -1.100 5.5e-07
Rheumatoid arthritis -1.300 3.1e-02
subependymal giant cell astrocytoma -6.953 2.0e-03

Protein-protein Interaction (3)

Gene RIF (79)

AA Sequence

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT      1 - 70
ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP     71 - 140
SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKS    141 - 210
HGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDA    211 - 280
QGTLSKIFKLGGRDSRSGSPMARR                                                  281 - 304
//

Text Mined References (158)

PMID Year Title