Property Summary

NCBI Gene PubMed Count 138
Grant Count 865
R01 Count 522
Funding $169,433,455.75
PubMed Score 5256.96
PubTator Score 3588.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
Multiple Sclerosis 498 7.743 3.9
Acute disseminated encephalomyelitis 8 5.498 2.7
Hypersensitivity reaction type II diseas... 235  5.211 2.6
Metachromatic leukodystrophy 13 4.83 2.4
Neuropathy 210 4.753 2.4
Brain disease 83 4.696 2.3
Chromosome 18q deletion syndrome 9 4.61 2.3
Neuromyelitis optica 20 3.954 2.0
Subacute sclerosing panencephalitis 10 3.809 1.9
Measles 20 3.805 1.9
Cerebrovascular disease 231 3.712 1.9
Myelitis 8 3.667 1.8
Progressive multifocal leukoencephalopat... 24  3.532 1.8
Spinal cord disease 22 3.441 1.7
Toxic encephalopathy 131 3.245 1.6
Finger agnosia 2 3.183 1.6
Rabies 19 3.162 1.6
Krabbe disease 11 3.156 1.6
Paraplegia 71 3.07 1.5
Tetanus 66 3.066 1.5
Autoimmune disease of central nervous sy... 1  4.0
Breast cancer 3,094
Demyelinating Diseases 7
Down syndrome 548
Duchenne muscular dystrophy 602
Experimental Autoimmune Encephalomyeliti... 7 
Eye disease 55 2.0
Pick disease 1,893
Rheumatoid Arthritis 1,160
acute quadriplegic myopathy 1,157
astrocytoma 1,493
atypical teratoid/rhabdoid tumor 1,095
cutaneous lupus erythematosus 1,056
dermatomyositis 933
ependymoma 2,514
glioblastoma 5,572
group 3 medulloblastoma 2,254
invasive ductal carcinoma 2,950
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
progressive supranuclear palsy 674
psoriasis 6,685
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.031
malignant mesothelioma -2.500 0.000
ependymoma -5.400 0.000
psoriasis -1.700 0.003
cutaneous lupus erythematosus -1.300 0.027
astrocytoma -1.300 0.000
glioblastoma -3.600 0.001
oligodendroglioma -1.800 0.000
osteosarcoma -3.119 0.000
group 3 medulloblastoma -7.000 0.000
atypical teratoid/rhabdoid tumor -5.500 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -4.600 0.003
Duchenne muscular dystrophy -1.009 0.000
acute quadriplegic myopathy -1.338 0.000
pancreatic ductal adenocarcinoma liver m... 1.817 0.010
lung cancer -3.800 0.000
pediatric high grade glioma -3.900 0.000
pilocytic astrocytoma -4.300 0.000
subependymal giant cell astrocytoma -6.953 0.002
Pick disease -2.200 0.000
progressive supranuclear palsy -2.100 0.008
Breast cancer -1.800 0.000
invasive ductal carcinoma -1.100 0.009
ovarian cancer -2.600 0.000
Down syndrome 1.500 0.010
dermatomyositis 1.800 0.001

Gene

MBP

PANTHER Protein Class (2)

PDB

1BX2   1FV1   1HQR   1K2D   1QCL   1YMM   1ZGL  

Gene RIF (74)

PMID Text
26781085 IL-17- and IL-22-secreting myelin specific CD4(+) T cells resistant to corticoids are associated with radiological activity of multiple sclerosis in early stages of the disease, mainly among Afrodescendant patients who, normally, have worse prognosis.
26756931 B cells from relapsing-remitting multiple sclerosis patients produce TNFa and IL6, and present MBP85-99 peptide
26526848 myelin basic protein has a role in activating CD4+ and CD8+ T lymphocytes in multiple sclerosis
26518750 Studies indicate that all myelin basic protein (MBP) isoforms are intrinsically disordered proteins (IDPs) that interact via molecular recognition fragments (MoRFs), which thereby undergo local disorder-to-order transitions.
26476704 This study observed a significantly increased myelin basic protein (MBP) and nuclear distribution protein nudE-like 1 (NDEL1) mRNA levels in FEP patients compared with controls.
25738751 Reduced myelin basic protein-induced CD4+ T-cell autoreactivity in interferon-beta-treated multiple sclerosis patients may be mediated by monocyte-derived interleukin-10
25276831 Negatively charged actin and calmodulin (CaM), as well as basic histone H1.3, inhibit MBP hydrolysis by competing with the proteasome and MBP, respectively, for binding their counterpart.
24739384 data reveal the first case of a pathophysiologically important autoantigen as a ubiquitin-independent substrate of the 26S proteasome.
24667176 Single nucleotide polymorphisms on genetic loci SOD2, MBP and C8orf42were not found significantly associated with advanced age-related macular degeneration in a Chinese cohort
23726766 In autistic children with allergic manifestations there were increased serum levels of MBP (and MAG) compared to those without allergies.
More...

AA Sequence

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT      1 - 70
ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP     71 - 140
SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKS    141 - 210
HGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDA    211 - 280
QGTLSKIFKLGGRDSRSGSPMARR                                                  281 - 304
//

Text Mined References (151)

PMID Year Title
26781085 2016 Interleukin-17- and interleukin-22-secreting myelin-specific CD4(+) T cells resistant to corticoids are related with active brain lesions in multiple sclerosis patients.
26756931 2016 Myelin Basic Protein-Induced Production of Tumor Necrosis Factor-? and Interleukin-6, and Presentation of the Immunodominant Peptide MBP85-99 by B Cells from Patients with Relapsing-Remitting Multiple Sclerosis.
26526848 2015 Early activation of CD4+ and CD8+ T lymphocytes by myelin basic protein in subjects with MS.
26518750 2015 MyelStones: the executive roles of myelin basic protein in myelin assembly and destabilization in multiple sclerosis.
26476704 2015 Increased expression of NDEL1 and MBP genes in the peripheral blood of antipsychotic-naïve patients with first-episode psychosis.
25738751 2015 Endogenous interferon-?-inducible gene expression and interferon-?-treatment are associated with reduced T cell responses to myelin basic protein in multiple sclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25276831 2014 Glatiramer acetate and nanny proteins restrict access of the multiple sclerosis autoantigen myelin basic protein to the 26S proteasome.
24739384 2014 Multiple sclerosis autoantigen myelin basic protein escapes control by ubiquitination during proteasomal degradation.
24667176 2014 Association study of newly identified age-related macular degeneration susceptible loci SOD2, MBP, and C8orf42 in Han Chinese population.
More...