Property Summary

NCBI Gene PubMed Count 259
PubMed Score 151.20
PubTator Score 163.80

Knowledge Summary


No data available



  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.262 0.027
non-small cell lung cancer -1.975 0.002
lung cancer -5.500 0.000
sarcoidosis -3.500 0.036
cystic fibrosis 1.400 0.006
aldosterone-producing adenoma -2.854 0.032
lung carcinoma -2.400 0.000



PANTHER Protein Class (1)


1DUG   1FIB   1FIC   1FID   1FZA   1FZB   1FZC   1FZE   1FZF   1FZG   1LT9   1LTJ   1N86   1N8E   1RE3   1RE4   1RF0   1RF1   2A45   2FFD   2FIB   2H43   2HLO   2HOD   2HPC   2HWL   2OYH   2OYI   2Q9I   2VDO   2VDP   2VDQ   2VDR   2VR3   2XNX   2XNY   2Y7L   2Z4E   3BVH   3E1I   3FIB   3GHG   3H32   3HUS   4B60  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (159)

27060305 5877G>A mutation in the exon 8 of the FGG gene is underlies the pathogenesis of congenital dysfibrinogenemia in a Chinese family.
27044366 Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls.
26663050 Data indicate that mutations of the fibrinogen (Fg) gene seem to aggregate to the D region of fibrinogen gamma chain (FGG)
26608329 Thrombin and fibrinogen gamma' regulate protofibril packing within fibrin fibers and thereby influence clot stiffness.
26494231 Suggest gamma' fibrinogen concentrations reflect general inflammation that accompanies and may contribute to atherosclerotic CVD, instead of gamma' fibrinogen being a causal risk factor.
26039544 Case Reports: clustering of mutations causing fibrinogen storage disease in the fibrinogen gamma chain between residues 284 and 375.
26037343 A novel mutation in FGG gene is associated with congenital hypofibrinogenemia.
25982359 congenital dysfibrinogenemia with a novel mutation in fibrinogen gamma chain (gamma322 Phe-->Ile, Fibrinogen Beijing) and haemophilia B in a family
25896761 This study presents the covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25788521 Low FI levels are strongly associated with rare CFI variants and age-related macular degeneration.

AA Sequence

GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL                                         421 - 453

Text Mined References (270)

PMID Year Title
27060305 2016 [Analysis of a family with congenital dysfibrinogenemia caused by an Arg275His mutation in the gamma chain of fibrinogen].
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
26663050 2015 [Analysis of molecular pathogenesis and clinical phenotypes in 10 probands with inherited fibrinogen deficiency].
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26608329 2016 Thrombin and fibrinogen ?' impact clot structure by marked effects on intrafibrillar structure and protofibril packing.
26494231 2015 Association of Plasma ?' Fibrinogen With Incident Cardiovascular Disease: The Atherosclerosis Risk in Communities (ARIC) Study.
26176881 2015 Fibrinogen storage disease and cirrhosis associated with hypobetalipoproteinemia owing to fibrinogen Aguadilla in a Turkish child.
26148065 2015 Specific Inflammatory Stimuli Lead to Distinct Platelet Responses in Mice and Humans.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26039544 2015 Hepatic fibrinogen storage disease: identification of two novel mutations (p.Asp316Asn, fibrinogen Pisa and p.Gly366Ser, fibrinogen Beograd) impacting on the fibrinogen ?-module.