Property Summary

NCBI Gene PubMed Count 272
PubMed Score 158.74
PubTator Score 163.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -2.854 3.2e-02
cystic fibrosis 1.400 6.4e-03
lung cancer -3.200 1.0e-04
lung carcinoma -2.400 4.7e-04
non-small cell lung cancer -1.975 2.5e-03
pancreatic ductal adenocarcinoma liver m... -2.262 2.7e-02
sarcoidosis -3.500 3.6e-02

PDB (45)

Gene RIF (170)

AA Sequence

MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLE      1 - 70
DILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIY     71 - 140
NSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEI    141 - 210
DGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWN    211 - 280
GRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG    281 - 350
NCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI    351 - 420
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL                                         421 - 453
//

Text Mined References (283)

PMID Year Title