Property Summary

NCBI Gene PubMed Count 361
Grant Count 1
Funding $42,229.5
PubMed Score 111.35
PubTator Score 15551.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -4.042 0.013
lung adenocarcinoma 1.500 0.002

Synonym

Accession P02675 A0JLR9 B2R7G3 Q32Q65 Q3KPF2
Symbols HEL-S-78p

Gene

FGB

PANTHER Protein Class (1)

 Grant Application (1)

PDB

1FZA   1FZB   1FZC   1FZE   1FZF   1FZG   1LT9   1LTJ   1N86   1N8E   1RE3   1RE4   1RF0   1RF1   2A45   2FFD   2H43   2HLO   2HOD   2HPC   2OYH   2OYI   2Q9I   2XNX   2XNY   2Z4E   3BVH   3E1I   3GHG   3H32   3HUS  

Gene RIF (314)

PMID Text
27044366 Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls.
26317125 desAB fibrin binds to prothrombin through the Bbeta26-42 amino acid residues and the formation of such a complex causes a non-enzymatic activation of prothrombin
26308135 Here we report a new B[beta] gene mutation (Fibrinogen St Kilda) identified in two Caucasian sisters with reduced fibrinogen level (1.2-1.6 g/L) during investigation for recurrent early miscarriages.
26077345 Strong positive association has been found between betatrophin, plasma fibrinogen (FBG), and insulin resistance in non-diabetic subjects. Correlations with FBG and insulin resistance were diminished in type 2 diabetes subjects.
26011420 This prospective study in 110 patients undergoing major cardiovascular surgery at risk of post-cardiopulmonary bypass bleeding compares fibrinogen level.
26006300 These experiments demonstrate, for the FGB-p.Asp185Asn mutation, a pathogenic mechanism not common for fibrinogen deficiencies, i.e. the hyperglycosylation of the Bbeta chain due to the introduction of a novel N-glycosylation motif.
25981141 The study reports two novel mutations detected in the FGA and FGB genes in two patients with inherited hypofibrinogenemia.
25896470 High plasma fibrinogen levels and platelet count are associated with esophageal squamous cell carcinoma.
25890854 Results suggest that FGB -148 C/T and -854 G/A polymorphisms probably contribute to susceptibility of ischemic stroke in Chinese population.
25867317 In the present study, we found that the -148C>T polymorphism in the FGB gene was significantly associated with ischemic stroke in a Chinese population [meta-analysis]
More...

AA Sequence

MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLRPAPPPISGGG      1 - 70
YRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQT     71 - 140
SSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQ    141 - 210
KLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWT    211 - 280
VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD    281 - 350
KVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP    351 - 420
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQ    421 - 490
Q//

Text Mined References (369)

PMID Year Title
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
26317125 2015 Non-enzymatic activation of prothrombin induced by interaction with fibrin ?26-42 region.
26308135 2015 Novel heterozygous Bbeta (c.1311T>A) mutation (Fibrinogen St Kilda) associated with recurrent pregnancy loss.
26077345 2015 Higher plasma betatrophin/ANGPTL8 level in Type 2 Diabetes subjects does not correlate with blood glucose or insulin resistance.
26011420 2015 Prediction of Post-Weaning Fibrinogen Status during Cardiopulmonary Bypass: An Observational Study in 110 Patients.
26006300 2015 Molecular characterization of 7 patients affected by dys- or hypo-dysfibrinogenemia: Identification of a novel mutation in the fibrinogen Bbeta chain causing a gain of glycosylation.
25981141 2015 Congenital hypofibrinogenemia associated with novel homozygous fibrinogen A? and heterozygous B? chain mutations.
25896470 2015 The clinical significance of preoperative plasma fibrinogen level and platelet count in resectable esophageal squamous cell carcinoma.
25890854 2015 Effect of the -148C/T, 448G/A, and -854G/A Polymorphisms of the ?-Fibrinogen Gene on the Risk of Ischemic Stroke in Chinese Population.
25867317 2015 Association between the FGB gene polymorphism and ischemic stroke: a meta-analysis.
More...