Property Summary

NCBI Gene PubMed Count 303
Grant Count 4
R01 Count 4
Funding $153,128.43
PubMed Score 716.25
PubTator Score 542.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.017 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.036
lung cancer -3.100 0.000
lung adenocarcinoma 1.300 0.043
ovarian cancer 1.100 0.000

Synonym

Accession P02671 A8K3E4 D3DP14 D3DP15 Q4QQH7 Q9BX62 Q9UCH2
Symbols Fib2

Gene

FGA

PANTHER Protein Class (1)

PDB

1FZA   1FZB   1FZC   1FZE   1FZF   1FZG   1LT9   1LTJ   1N86   1N8E   1RE3   1RE4   1RF0   1RF1   2A45   2FFD   2H43   2HLO   2HOD   2HPC   2OYH   2OYI   2Q9I   2XNX   2XNY   2Z4E   3BVH   3E1I   3GHG   3H32   3HUS   1BBR   1DM4   1FPH   1FZD   1YCP   3AT0   4F27   5CFA  

 GWAS Trait (1)

Gene RIF (197)

PMID Text
27044366 Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls.
26256740 Nutrient overload-induced up-regulation of all three fibrinogen component subunits of the coagulation cascade provides a possible mechanism to explain the excess cardiovascular disease mortality observed in non-alcoholic fatty liver disease patients.
26228839 No association between cognition and gene polymorphisms involved in thrombosis and haemostasis
26083984 To novel fibrinogen mutations have been identified (Aa17GlyalphaCys and Aa381SeralphaPhe) that cosegregate with dysfibrinogenemia in seven family members of a Chinese pedigree.
25981141 The study reports two novel mutations detected in the FGA and FGB genes in two patients with inherited hypofibrinogenemia.
25923092 Tissue factor (TF) and fibrinogen in peripheral artery disease patients undergoing endovascular revascularization can participate in the formation of restenosis.
25896761 This study presents the covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25569856 The Aalpha-Val360 related cross-sectionally to physiologic, radiologic, and symptomatic markers of disease severity of PiZZ alpha1-antitrypsin deficiency.
25555432 An analysis of the results obtained in this study and a critical review of previously published data indicate that gene polymorphisms in FGA and FGB are not related to ischemic stroke in children
25393591 Results support the idea that fibrinogen alphaC regions are involved in the thickening of fibrin fibers.
More...

AA Sequence

MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRM      1 - 70
KGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEV     71 - 140
LKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAK    141 - 210
DLLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTG    211 - 280
SETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPG    281 - 350
SPRPGSTGTWNPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV    351 - 420
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSD    421 - 490
CPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKES    491 - 560
SSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVR    561 - 630
DCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN    631 - 700
DEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGS    701 - 770
VEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG    771 - 840
VVWVSFRGADYSLRAVRMKIRPLVTQ                                                841 - 866
//

Text Mined References (316)

PMID Year Title
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26256740 2015 Fibrinogen production is enhanced in an in-vitro model of non-alcoholic fatty liver disease: an isolated risk factor for cardiovascular events?
26228839 2015 Association between cognition and gene polymorphisms involved in thrombosis and haemostasis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26083984 2015 Novel fibrinogen mutations (A?17Gly?Cys and A?381Ser?Phe) occurring with a 312Thr?Ala polymorphism: allelic phase assigned by direct mass measurement.
25981141 2015 Congenital hypofibrinogenemia associated with novel homozygous fibrinogen A? and heterozygous B? chain mutations.
25923092 Tissue factor and other hemostatic parameters in patients with advanced peripheral artery disease after endovascular revascularization - search for hemostatic factors which indicate restenosis.
25896761 2015 Covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25569856 2015 The Relationship of the Fibrinogen Cleavage Biomarker A?-Val360 With Disease Severity and Activity in ?1-Antitrypsin Deficiency.
More...