Property Summary

NCBI Gene PubMed Count 353
Grant Count 135
R01 Count 78
Funding $24,632,885.24
PubMed Score 836.71
PubTator Score 678.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 0.000

Synonym

Accession P02656 Q08E83 Q6Q786 Apo-CIII
Symbols HALP2
APOCIII

Gene

PANTHER Protein Class (2)

PDB

2JQ3  

Gene RIF (346)

PMID Text
26996551 ApoA-1 and ApoC-III may be used as differentiating and predictive markers for SCLC [ small cell lung cancer ].
26790392 D25V apolipoprotein C-III is a new human amyloidogenic protein and the first conferring cardioprotection.
26782469 The results of our meta-analysis point to a strong link between both APOA5 -1131T>C and APOC3 -455T>C polymorphisms and an increased risk of coronary heart disease .
26625519 In examined Kyrgyz ethnic population the most frequent was heterozygous TC genotype of T455C polymorphism of apo C-III.
26516010 APOC3 loss-of- function mutation carriers had reduced plasma triglycerides, higher HDL-C,and a decreased burden of coronary arterial calcification.
26491253 Low levels of APOA1, APOC3, and APOA4 are associated with risk of Alzheimer disease.
26485402 the present findings reveal that High-altitude polycythemia -induced gastric mucosal lesion inspires the protection responses by up-regulating APOA4 and APOC3, and down-regulating GIF.
26452348 HDL-apoCIII has a significant and positive association with coronary heart disease .
26387083 APOA5 -1131 T > C and APOC3 -455 T > C SNPs may play potent roles in the development and progression of coronary heart disease. (Meta-analysis)
26301570 Data suggest that apolipoprotein C-III (ApoCIII) adopts an alternate helical conformation on the bilayer which could have functional implications.
More...

AA Sequence

MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL      1 - 70
KDYWSTVKDKFSEFWDLDPEVRPTSAVAA                                              71 - 99
//

Text Mined References (358)

PMID Year Title
26996551 2016 Apolipoproteins as Differentiating and Predictive Markers for Assessing Clinical Outcomes in Patients with Small Cell Lung Cancer.
26790392 2016 D25V apolipoprotein C-III variant causes dominant hereditary systemic amyloidosis and confers cardiovascular protective lipoprotein profile.
26782469 2015 APOA5 -1131T>C and APOC3 -455T>C polymorphisms are associated with an increased risk of coronary heart disease.
26625519 2015 [An Association Between T455C Polymorphism of Apolipoprotein C-III Gene, Insulin Resistance and Metabolic Syndrome Components].
26516010 2015 Association of APOC3 Loss-of-Function Mutations With Plasma Lipids and Subclinical Atherosclerosis: The Multi-Ethnic BioImage Study.
26491253 2015 Decreased expression of the APOA1-APOC3-APOA4 gene cluster is associated with risk of Alzheimer's disease.
26485402 2015 Transcriptome Reveals 1400-Fold Upregulation of APOA4-APOC3 and 1100-Fold Downregulation of GIF in the Patients with Polycythemia-Induced Gastric Injury.
26452348 2015 The association of HDL-apoCIII with coronary heart disease and the effect of statin treatment on it.
26387083 2015 Apolipoprotein A5 and apolipoprotein C3 single nucleotide polymorphisms are correlated with an increased risk of coronary heart disease: a case-control and meta-analysis study.
26301570 2015 Tryptophan probes reveal residue-specific phospholipid interactions of apolipoprotein C-III.
More...