Property Summary

NCBI Gene PubMed Count 375
PubMed Score 875.18
PubTator Score 678.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 1.3e-05

Gene RIF (363)

AA Sequence

MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL      1 - 70
KDYWSTVKDKFSEFWDLDPEVRPTSAVAA                                              71 - 99
//

Text Mined References (380)

PMID Year Title