Property Summary

NCBI Gene PubMed Count 113
Grant Count 15
R01 Count 7
Funding $1,703,767.33
PubMed Score 337.41
PubTator Score 329.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (59)

PMID Text
26196342 The results highlight the importance of charge-pair interactions within the apoC-II fibril core
26026161 Conformational rearrangement of apoC-II at lipoprotein surfaces promotes interaction with LPL.
25172036 Large deletion in APOC2 caused by Alu-Alu homologous recombination is associated with with apolipoprotein C-II deficiency.
25131724 No APOC2 mutations were identified in a cohort of patients with diabetic lipemia.
23631828 Six apolipoproteins (APOA1, APOA2, APOB, APOC2, APOC3, and APOE) were able to differentiate bladder cancer from hernia. SAA4 was significantly increased in bladder cancer subgroups, whereas ProEGF was significantly decreased in bladder cancer subgroups.
22808166 STAT1 bound on multienhancer 2 cooperates with RXRalpha located on apoCII promoter and upregulates apoCII expression only in macrophages.
22244853 Substoichiometric concentrations of cyc[60-70] significantly delayed fibril formation by the fibrillogenic, linear peptides apoC-II[60-70] and apoC-II[56-76].
22239554 Mutations in GPIHBP1 are rare but the associated clinical phenotype of hypertriglyceridaemia is severe
21985034 Activation of apoC-II fibrils by submicellar lipid (NBD-lyso-12-phosphocholine) is catalytic with release of monomer- and tetramer-bound lipid accompanying fibril elongation and growth.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
More...

AA Sequence

MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK      1 - 70
LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE                                            71 - 101
//

Text Mined References (117)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26196342 2015 Hydrogen/Deuterium Exchange and Molecular Dynamics Analysis of Amyloid Fibrils Formed by a D69K Charge-Pair Mutant of Human Apolipoprotein C-II.
26026161 2015 A Pressure-dependent Model for the Regulation of Lipoprotein Lipase by Apolipoprotein C-II.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25172036 2015 Apolipoprotein C-II Tuzla: a novel large deletion in APOC2 caused by Alu-Alu homologous recombination in an infant with apolipoprotein C-II deficiency.
25131724 2014 Quantification and genotyping of lipoprotein lipase in patients with diabetic lipaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23631828 2013 Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
More...