Property Summary

NCBI Gene PubMed Count 115
PubMed Score 342.66
PubTator Score 329.94

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (61)

AA Sequence

MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK      1 - 70
LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE                                            71 - 101
//

Text Mined References (119)

PMID Year Title