Property Summary

NCBI Gene PubMed Count 166
Grant Count 42
R01 Count 20
Funding $5,100,512.81
PubMed Score 252.92
PubTator Score 215.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (107)

PMID Text
26639962 This sbioinformatics analysis explored the shared genetic etiology underlying Type 2 Diabetes and Alzheimer's Disease on SNP level, gene level, and pathway level. Six SNPs on APOC1 gene.
26576771 APOC1 SNP is associated with the A beta-42 levels in CSF.
24582705 APOE e4 allele status is associated with dementia and severity of Alzheimer's disease pathologic features in Parkinson disease.
24574346 The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes.
24498013 Data indicate that apolipoprotein C-I (APOC1) rs11568822 polymorphism was associated with increased Alzheimer's disease (AD) risk in Caucasians, Asians and Caribbean Hispanics, but not in African Americans.
24121499 apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4.
23670531 results suggest that peptide-lipid interactions drive alpha-helix binding to and retention on lipoproteins
23620136 Helical domains that mediate lipid solubilization and ABCA1-specific cholesterol efflux in apolipoproteins C-I and A-II
23555584 Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of apolipoprotein C-I (APOC1) in peptide-treated PBMCs
More...

AA Sequence

MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE      1 - 70
TFQKVKEKLKIDS                                                              71 - 83
//

Text Mined References (170)

PMID Year Title
26639962 2016 Shared Genetic Etiology between Type 2 Diabetes and Alzheimer's Disease Identified by Bioinformatics Analysis.
26576771 2016 Combined Genome-Wide CSF A?-42's Associations and Simple Network Properties Highlight New Risk Factors for Alzheimer's Disease.
25785516 2015 Human endogenous retrovirus group E and its involvement in diseases.
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25160599 2014 Higher primates, but not New World monkeys, have a duplicate set of enhancers flanking their apoC-I genes.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
24582705 2014 Clinical and pathologic presentation in Parkinson's disease by apolipoprotein e4 allele status.
24574346 2014 Glycation of apolipoprotein C1 impairs its CETP inhibitory property: pathophysiological relevance in patients with type 1 and type 2 diabetes.
More...