Property Summary

NCBI Gene PubMed Count 143
Grant Count 73
R01 Count 40
Funding $10,003,574.46
PubMed Score 593.92
PubTator Score 553.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02652 B2R524 Apo-AII
Symbols apoAII
Apo-AII
ApoA-II

Gene

PDB

1L6L   2OU1  

Gene RIF (94)

PMID Text
26682220 ApoA1 and ApoA2 were independently associated with cognitive impairment.
26590203 A new missense mutation in an Iranian population has a significant association with high-density lipoprotein cholesterol levels.
26549697 ApoAII-ATQ/AT not only distinguished the early stages of pancreatic cancer from healthy controls but also identified patients at high risk for pancreatic malignancy.
26104730 APOA-II polymorphism and oxidative stress is associated with poor prognosis in patients with type 2 diabetes.
26071654 Plasma apoB pool size of VLDL containing apoA-II is much smaller than that of VLDL without apoA-II, and this was caused by a very low rate of secretion of this VLDL type into plasma.
25979856 Clematichinenoside prevented dyslipidemia-induced atherosclerosis via hepatic PPARalpha/APOA1/APOA2/APOC3 metabolism.
25953375 Apolipoprotein A-II/B significantly improves risk prediction of overall survival, also in carotid surgery patients with lower LDL levels
24633472 Apolipoprotein AII was detected as a protein associated with the urinary protein/urinary creatinine levels in pediatric idiopathic steroid-sensitive nephrotic syndrome
24116940 We have cloned the cDNA encoding human ApoA-II and achieved its high-level secreting expression with a yield of 65 mg/L of yeast culture
24108135 identified a statistically significant interaction between the APOA2 -265T > C variant and higher-fat dairy food intake in the Boston Puerto Ricans and replicated this relation in the GOLDN study
More...

AA Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKE      1 - 70
QLTPLIKKAGTELVNFLSYFVELGTQPATQ                                             71 - 100
//

Text Mined References (149)

PMID Year Title
26682220 2015 Serum Levels of ApoA1 and ApoA2 Are Associated with Cognitive Status in Older Men.
26590203 2016 Identification of Sequence Variation in the Apolipoprotein A2 Gene and Their Relationship with Serum High-Density Lipoprotein Cholesterol Levels.
26549697 2015 Plasma biomarker for detection of early stage pancreatic cancer and risk factors for pancreatic malignancy using antibodies for apolipoprotein-AII isoforms.
26104730 Association between ApoA-II -265T/C polymorphism and oxidative stress in patients with type 2 diabetes mellitus.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26071654 2015 Metabolism of apolipoprotein A-II containing triglyceride rich ApoB lipoproteins in humans.
25979856 2015 An experimental study on amelioration of dyslipidemia-induced atherosclesis by Clematichinenoside through regulating Peroxisome proliferator-activated receptor-? mediated apolipoprotein A-I, A-II and C-III.
25953375 2015 Ratio of Apolipoprotein A-II/B Improves Risk Prediction of Postoperative Survival After Carotid Endarterectomy.
25416956 2014 A proteome-scale map of the human interactome network.
24633472 2015 Apolipoprotein AII levels are associated with the UP/UCr levels in idiopathic steroid-sensitive nephrotic syndrome.
More...