Property Summary

NCBI Gene PubMed Count 146
PubMed Score 595.21
PubTator Score 553.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (96)

AA Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKE      1 - 70
QLTPLIKKAGTELVNFLSYFVELGTQPATQ                                             71 - 100
//

Text Mined References (152)

PMID Year Title