Property Summary

NCBI Gene PubMed Count 824
Grant Count 527
R01 Count 306
Funding $74,356,614.46
PubMed Score 3516.74
PubTator Score 4684.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.800 0.002
psoriasis -1.400 0.000

Synonym

Accession P02647 A8K866 Q6LDN9 Q6Q785 Q9UCS8 Q9UCT8 Apo-AI
Symbols apo(a)

Gene

PDB

1AV1   1GW3   1GW4   1ODP   1ODQ   1ODR   2A01   2MSC   2MSD   2MSE   3K2S   3R2P   4V6M  

Gene RIF (714)

PMID Text
26996551 Expression of ApoA-1 and ApoC-III in SCLC was significantly different, compared with that in NSCLC and normal lung tissues, and was correlated with recurrence of SCLC.
26820473 [1-93]ApoA-I induces conformational disorder in an ordered lipid bilayer.
26819136 Static and dynamic light scattering were employed to determine simultaneously the average relative molecular mass, Mr, and the average hydrodynamic radius, Rh, of protein molecules. The new method was applied to the association-dissociation equilibrium of apolipoprotein A-1 (Apo A-1) and its thermal unfolding.
26774504 this study aimed to investigate the relationship between ABCA1 polymorphism and apoA-I and HDL-C in an attempt to elucidate its correlation with abdominal aortic aneurysm occurrence.
26758372 Increased plasma homocysteine(Hcy) levels were associated with decreased apoAI levels in healthy people, and the inhibition of apoAI synthesis might be a mechanism through which Hcy is linked with the development of atherosclerosis in hyperHcy subjects.
26687706 phenotype in a child with familial HDL deficiency due to a novel frameshift mutation in APOA1 gene
26682220 ApoA1 and ApoA2 were independently associated with cognitive impairment.
26681753 Identify C-terminal cleavage of apoA-I by human mast cell chymase as a novel mechanism leading to loss of its anti-inflammatory functions.
26662883 protein(s) in the homogenate interact with HDL protein(s), leading to release of Apo A1 from the HDL particle, a process that was associated with an increase in HDL diameter and with impaired HDL anti-oxidant activity.
26621275 The incidence of allele (-75)A was 22.5%, of allele (+83)T - 7.3%. Association of allele (-75) A with high blood cholesterol level was revealed.
More...

AA Sequence

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKL      1 - 70
LDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR     71 - 140
QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG    141 - 210
ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ                 211 - 267
//

Text Mined References (832)

PMID Year Title
26996551 2016 Apolipoproteins as Differentiating and Predictive Markers for Assessing Clinical Outcomes in Patients with Small Cell Lung Cancer.
26820473 2016 Insights into the interaction of the N-terminal amyloidogenic polypeptide of ApoA-I with model cellular membranes.
26819136 2016 Self-Association of Apo A-1 Studied with Dynamic and Static Light Scattering.
26774504 2016 Correlation Between ABCA1 Gene Polymorphism and aopA-I and HDL-C in Abdominal Aortic Aneurysm.
26758372 2016 Hyperhomocysteinemia is associated with decreased apolipoprotein AI levels in normal healthy people.
26687706 A complex phenotype in a child with familial HDL deficiency due to a novel frameshift mutation in APOA1 gene (apoA-IGuastalla).
26682220 2015 Serum Levels of ApoA1 and ApoA2 Are Associated with Cognitive Status in Older Men.
26681753 2016 Carboxyl-Terminal Cleavage of Apolipoprotein A-I by Human Mast Cell Chymase Impairs Its Anti-Inflammatory Properties.
26662883 Human carotid atherosclerotic plaque protein(s) change HDL protein(s) composition and impair HDL anti-oxidant activity.
26621275 2015 Association of Apolipoprotein A1 Gene Polymorphisms with Serum Lipid Spectrum in Adolescents in East Siberia.
More...