Property Summary

NCBI Gene PubMed Count 878
PubMed Score 3592.82
PubTator Score 4684.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 2.3e-08
ovarian cancer 8520 2.0e-03
Disease Target Count Z-score Confidence
Tangier disease 10 0.0 5.0
Disease Target Count Z-score Confidence
Atherosclerosis 291 6.568 3.3
Amyloidosis 67 4.714 2.4
Neuropathy 261 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.800 2.0e-03
psoriasis -1.400 2.3e-08

Protein-protein Interaction (4)

Gene RIF (761)

AA Sequence

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKL      1 - 70
LDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR     71 - 140
QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG    141 - 210
ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ                 211 - 267
//

Text Mined References (887)

PMID Year Title