1. Home
  2. Targets
  3. calcium-binding protein
  4. actin family cytoskeletal protein
  5. calmodulin
  6. Troponin C, skeletal muscle

Tchem Troponin C, skeletal muscle

Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.42
PubTator Score 9.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (11)

Disease Z-score Confidence
Distal arthrogryposis 45 4.461 2.2
Clubfoot 35 3.505 1.8
Spondylolisthesis 13 3.475 1.7
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
diabetes mellitus 1,663
ependymoma 2,514
glioblastoma 5,572
oligodendroglioma 2,849
primitive neuroectodermal tumor 3,031
psoriasis 6,685

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.006
ependymoma -1.200 0.007
oligodendroglioma -1.300 0.003
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
primitive neuroectodermal tumor -1.100 0.000
diabetes mellitus -1.500 0.036
psoriasis -1.300 0.000

Synonym

Accession P02585 Q6FH92
Symbols

Gene

TNNC2

PANTHER Protein Class (3)

 GO Function (3)

 GO Component (2)

 GO Process (3)

 Compartment GO Term (27)

See all...

Pathway (53)

See all...

 UniProt Keyword (8)

Ligand (1)

Structure of CHEMBL386051

CHEMBL386051
pKd 8.00

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of troponin C type 2 (TNNC2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
1907279 HIV-1 protease hydrolyzes troponin C at amino acid residues 101-102

AA Sequence 

MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT      1 - 70
IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD     71 - 140
KNNDGRIDFDEFLKMMEGVQ                                                      141 - 160
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17194691 2007 Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9560191 1998 Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
9459007 1997 Assignment of the human fast skeletal muscle troponin C gene (TNNC2) between D20S721 and GCT10F11 on chromosome 20 by somatic cell hybrid analysis.
More...