Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.68
PubTator Score 9.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 6.4e-03
atypical teratoid / rhabdoid tumor -1.100 2.4e-06
diabetes mellitus -1.500 3.6e-02
ependymoma -1.200 6.7e-03
glioblastoma -1.100 9.1e-06
oligodendroglioma -1.300 3.1e-03
primitive neuroectodermal tumor -1.100 2.3e-04
psoriasis -1.300 7.1e-35

Gene RIF (4)

AA Sequence

MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT      1 - 70
IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD     71 - 140
KNNDGRIDFDEFLKMMEGVQ                                                      141 - 160
//

Text Mined References (16)

PMID Year Title