Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.42
PubTator Score 9.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.006
ependymoma -1.200 0.007
oligodendroglioma -1.300 0.003
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
primitive neuroectodermal tumor -1.100 0.000
diabetes mellitus -1.500 0.036
psoriasis -1.300 0.000

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of troponin C type 2 (TNNC2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
1907279 HIV-1 protease hydrolyzes troponin C at amino acid residues 101-102

AA Sequence

MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT      1 - 70
IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD     71 - 140
KNNDGRIDFDEFLKMMEGVQ                                                      141 - 160
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17194691 2007 Mutations in fast skeletal troponin I, troponin T, and beta-tropomyosin that cause distal arthrogryposis all increase contractile function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9560191 1998 Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
9459007 1997 Assignment of the human fast skeletal muscle troponin C gene (TNNC2) between D20S721 and GCT10F11 on chromosome 20 by somatic cell hybrid analysis.
More...