Property Summary

NCBI Gene PubMed Count 40
Grant Count 13
R01 Count 8
Funding $3,777,411.25
PubMed Score 78.64
PubTator Score 148.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -4.900 0.023
psoriasis 4.500 0.000
cutaneous lupus erythematosus 2.400 0.000
osteosarcoma 1.085 0.000
Atopic dermatitis 2.000 0.001
non-small cell lung cancer 5.849 0.000
lung cancer -3.900 0.035
pancreatic cancer 2.000 0.004
nasopharyngeal carcinoma -1.900 0.021
spina bifida -2.107 0.040
ulcerative colitis 2.100 0.011

Gene RIF (18)

PMID Text
24708461 we here describe a family with pachyonychia congenita K6a, manifesting atypical symptoms of impaired wound healing and cheilitis.
24326984 CK5/6, but not c-Met expression, seems to be important in lymphatic metastasis
23075894 Data show that calretinin and CK5/6 were positive in 100 and 64% of mesotheliomas, and 92 and 31% of reactive effusions, respectively, and desmin was negative in all malignant cases and positive in 85% of reactive effusions.
23006328 Keratin-derived antimicrobial peptides (KDAMPs) and their synthetic analogs exhibit antimicrobial activity against bacterial pathogens.
22668561 Genotype-phenotype correlations among PC patients with codon-125 mutation in KRT16 were established, while the phenotypes caused by the IVS8-2A>C mutation in KRT6A need further studies to confirm the rare feature of fissured tongue
22264670 We observed a higher likelihood of oral leukokeratosis in individuals harboring KRT6A mutations.
22098151 Phenotypic differences exist between KRT6A and KRT16 mutations support adoption of a new classification system.
21554383 This report is the first case of pachyonychia congenita with laryngeal obstruction in which the gene mutation has been established (a deletional mutation in keratin 6a).
20470930 Focal palmoplantar keratoderma is associated with mutations in keratin K6c in 3 families. 2 unrelated families have Asn172 del and the other has a deletion of AA 462-470. Review.
20403371 these data highlight the possibility of a physiological role for K6/K16 heterodimers in keratinocyte cell migration, in addition to the heterodimer's known functions in cell differentiation and mechanical resilience.
More...

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQ    421 - 490
STVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (47)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24708461 2015 Impaired wound healing and cheilitis in a Pachyonychia congenita K6a family.
24326984 2014 Cytokeratin 5/6, c-Met expressions, and PTEN loss prognostic indicators in triple-negative breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23662636 2013 Collapse of the keratin filament network through the expression of mutant keratin 6c observed in a case of focal plantar keratoderma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23075894 2012 The diagnostic utility of D2-40, calretinin, CK5/6, desmin and MOC-31 in the differentiation of mesothelioma from adenocarcinoma in pleural effusion cytology.
23006328 2012 Cytokeratins mediate epithelial innate defense through their antimicrobial properties.
22668561 Two novel de novo mutations of KRT6A and KRT16 genes in two Chinese pachyonychia congenita pedigrees with fissured tongue or diffuse plantar keratoderma.
22264670 2012 A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita.
More...