Property Summary

NCBI Gene PubMed Count 115
Grant Count 158
R01 Count 85
Funding $9,591,625.62
PubMed Score 690.44
PubTator Score 613.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -3.700 0.029
cystic fibrosis -5.961 0.000
non-small cell lung cancer 4.300 0.000
nasopharyngeal carcinoma -3.100 0.000
breast carcinoma -3.800 0.000
spina bifida -2.304 0.037
Breast cancer -6.300 0.000
ovarian cancer 1.800 0.006
chronic rhinosinusitis 3.596 0.001

Synonym

Accession P02533 Q14715 Q53XY3 Q9BUE3 Q9UBN2 Q9UBN3 Q9UCY4
Symbols K14
NFJ
CK14
EBS3
EBS4

Gene

PDB

3TNU  

Gene RIF (60)

PMID Text
26831077 findings reveal K14 as a key regulator of metastasis and establish the concept that K14(+) epithelial tumor cell clusters disseminate collectively to colonize distant organs
26432462 identification of 29 different mutations in KRT5 and KRT14, 11 of which were novel, in a Polish cohort of epidermolysis bullosa simplex patients
26430881 all keratins tested, except for keratin 14, were evenly expressed in all trophoblast cells. Keratin 14 was expressed in a subset of CK7 positive cells
26216883 Analysis of K14 variants with single or multiple substitutions of cysteine residues points to a spatial and temporal hierarchy in how Cys-4/Cys-40 and Cys-367 regulate keratin assembly in vitro and filament dynamics in live keratinocytes
25961909 KRT14 protein genetic mutation is a good indicator of disease progression in patient diagnosed with epidermolysis bullosa simplex.
25643514 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder.
25017986 in silico analysis of all epidermolysis bullosa simplex causing point mutations on the 2B domain of K5 and K14; result showed all pathogenic point mutations exert their dominant negative effect on the K5/K14 coiled-coil heterodimer complex by altering interchain interaction,leading to changes in stability and assembly competence of the heterodimer complex
24981776 report a family with a novel heterozygous missense mutation p.Leu418Gln in the KRT14 gene causing epidermolysis bullosa simplex with variable phenotype
24940650 plectin interacts with keratins 5 and 14 in a process associated with epidermolysis bullosa simplex
24471966 keratin14 expression can be used to detect early epithelial dysplasia, and that keratin13 and keratin17 expression are useful for detecting neoplastic changes
More...

AA Sequence

MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYG      1 - 70
GGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEAN     71 - 140
ADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNL    141 - 210
RMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDL    211 - 280
SRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLS    281 - 350
MKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLE    351 - 420
GEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN                      421 - 472
//

Text Mined References (120)

PMID Year Title
26831077 2016 Polyclonal breast cancer metastases arise from collective dissemination of keratin 14-expressing tumor cell clusters.
26432462 2016 Novel sporadic and recurrent mutations in KRT5 and KRT14 genes in Polish epidermolysis bullosa simplex patients: further insights into epidemiology and genotype-phenotype correlation.
26430881 2015 A Unique Expression of Keratin 14 in a Subset of Trophoblast Cells.
26216883 2015 Complementary roles of specific cysteines in keratin 14 toward the assembly, organization, and dynamics of intermediate filaments in skin keratinocytes.
25961909 2015 Distinct Impact of Two Keratin Mutations Causing Epidermolysis Bullosa Simplex on Keratinocyte Adhesion and Stiffness.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25643514 2014 Expression of cytokeratin 7, 20, 14 in urothelial carcinoma and squamous cell carcinoma of the Egyprian urinary bladder cancer.
25017986 2014 In silico analysis of all point mutations on the 2B domain of K5/K14 causing epidermolysis bullosa simplex: a genotype-phenotype correlation.
24981776 2014 Novel KRT14 mutation causing epidermolysis bullosa simplex with variable phenotype.
24940650 2014 Interaction of plectin with keratins 5 and 14: dependence on several plectin domains and keratin quaternary structure.
More...