Property Summary

NCBI Gene PubMed Count 154
Grant Count 118
R01 Count 112
Funding $26,511,863.45
PubMed Score 658.36
PubTator Score 91.82

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02489 Q53X53
Symbols CRYA1
HSPB4
CTRCT9

Gene

PANTHER Protein Class (1)

Gene RIF (113)

PMID Text
26975472 alphaA-crystallin membrane insertion is oligomer-size dependent
26867756 The p.R21Q mutation of CRYAA is the most likely cause of paediatric cataract in this family.
26719333 Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf.
26700637 isomerization of Asp might disrupt the higher order polymeric state of alpha-crystallin, resulting in decreased solubility and function, ultimately contributing to lens protein impairment and cataract formation with aging
26657544 Similar to wild type alphaA- and alphaB-crystallins, the deamidated mutants showed strong interaction with betaA3-crystallin.
26459035 these results suggest that individuals carrying the alphaA-Crystallin R12C mutation are at an increased risk to develop early-onset cataract under condition of oxidative stress
26351848 In the lens epithelium of the high myopia-related cataract group and the age related cataract group, the mRNA and soluble protein expression of aA- and aB-crystallin were both decreased.
26116912 Since alpha-crystallins play an important role in preventing cataract in the eye lens and in the development of diverse diseases, understanding their mechanism and substrate spectra is of importance. [review]
26080000 Congenital cataract causing arginine mutations alters the structure and decreases the chaperone function of alpha-crystallin. These mutations also affect the lens morphology and phenotypes (review).
26004348 Identification of a novel mutation in CRYAA associated with congenital cataracts.
More...

AA Sequence

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDK      1 - 70
FVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLT     71 - 140
FCGPKIQTGLDATHAERAIPVSREEKPTSAPSS                                         141 - 173
//

Text Mined References (160)

PMID Year Title
26975472 2016 Membrane insertion of ?A-crystallin is oligomer-size dependent.
26867756 2016 Recurrent mutation in the crystallin alpha A gene associated with inherited paediatric cataract.
26719333 2016 Regulation of c-Maf and ?A-Crystallin in Ocular Lens by Fibroblast Growth Factor Signaling.
26700637 2016 Isomerization of Asp residues plays an important role in ?A-crystallin dissociation.
26657544 2015 Interaction of ?A3-Crystallin with Deamidated Mutants of ?A- and ?B-Crystallins.
26459035 2015 The impact of Hydrogen peroxide on structure, stability and functional properties of Human R12C mutant ?A-crystallin: The imperative insights into pathomechanism of the associated congenital cataract incidence.
26351848 2015 UPR Activation and the Down-Regulation of ?-Crystallin in Human High Myopia-Related Cataract Lens Epithelium.
26116912 2016 Structure and function of ?-crystallins: Traversing from in vitro to in vivo.
26080000 2016 Differential role of arginine mutations on the structure and functions of ?-crystallin.
26004348 2015 Mutation analysis of two families with inherited congenital cataracts.
More...