Property Summary

NCBI Gene PubMed Count 164
PubMed Score 682.15
PubTator Score 91.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (120)

AA Sequence

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDK      1 - 70
FVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLT     71 - 140
FCGPKIQTGLDATHAERAIPVSREEKPTSAPSS                                         141 - 173
//

Text Mined References (170)

PMID Year Title