Property Summary

NCBI Gene PubMed Count 166
Grant Count 26
R01 Count 12
Funding $3,689,972.78
PubMed Score 170.26
PubTator Score 146.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (69)

Disease Z-score Confidence
Porencephaly 8 7.122 3.6
Alport syndrome 21 3.928 2.0
Cadasil 9 3.648 1.8
pseudo-TORCH syndrome 5 3.536 1.8
Cerebrovascular disease 231 3.427 1.7
Cerebral palsy 28 3.247 1.6
Kidney disease 396 3.243 1.6
Angiopathy, Hereditary, With Nephropathy... 1 
Atherosclerosis 275 2.0
BRAIN SMALL VESSEL DISEASE WITH HEMORRHA... 1 
BRAIN SMALL VESSEL DISEASE WITH OR WITHO... 1 
Becker muscular dystrophy 187
Breast cancer 3,094
Calcification of coronary artery 3
Carcinoma 2,147 1.0
Congenital porencephaly 1
Diabetic Nephropathy 37
Duchenne muscular dystrophy 602
Familial vascular leukoencephalopathy 1
Focal glomerulosclerosis 22
HEMORRHAGE, INTRACEREBRAL, SUSCEPTIBILIT... 1 
Hydrolethalus syndrome 128
Infectious Canine Hepatitis 2
Nephrotic Syndrome 48
Obesity 616
PORENCEPHALY, FAMILIAL 2
RETINAL ARTERIES, TORTUOSITY OF 1
Schizencephaly 4
Walker-Warburg congenital muscular dystr... 14 
active Crohn's disease 918
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
dermatomyositis 933
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2B 74
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
periodontitis 269
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
pterygium 74
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (44)

Disease log2 FC p
nephrosclerosis 1.143 0.000
urothelial carcinoma 4.300 0.000
malignant mesothelioma -2.900 0.000
posterior fossa group A ependymoma 2.900 0.000
esophageal adenocarcinoma 1.800 0.034
cutaneous lupus erythematosus 1.200 0.002
psoriasis 1.800 0.005
astrocytoma 1.100 0.000
glioblastoma 3.700 0.000
oligodendroglioma 1.400 0.000
osteosarcoma 2.445 0.003
sonic hedgehog group medulloblastoma 2.500 0.000
cystic fibrosis -2.359 0.000
periodontitis 1.300 0.000
atypical teratoid / rhabdoid tumor 2.400 0.000
medulloblastoma, large-cell 2.100 0.000
primitive neuroectodermal tumor 1.700 0.002
Duchenne muscular dystrophy 1.657 0.000
autosomal dominant Emery-Dreifuss muscul... 1.269 0.025
Becker muscular dystrophy 1.536 0.014
juvenile dermatomyositis 1.912 0.000
limb girdle muscular dystrophy 2B 1.064 0.011
adrenocortical carcinoma 1.054 0.022
primary pancreatic ductal adenocarcinoma 3.264 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.034
intraductal papillary-mucinous carcinoma... -1.600 0.012
Hydrolethalus syndrome 1.882 0.029
lung cancer 1.500 0.000
active Crohn's disease 1.036 0.045
breast carcinoma -1.100 0.009
Breast cancer 4.200 0.025
interstitial cystitis 2.600 0.000
pediatric high grade glioma 2.600 0.000
pilocytic astrocytoma 2.300 0.000
subependymal giant cell astrocytoma 2.074 0.030
nasopharyngeal carcinoma 2.400 0.000
lung adenocarcinoma 1.078 0.000
gastric carcinoma 2.300 0.004
pterygium 1.300 0.003
ulcerative colitis 3.000 0.000
ovarian cancer 3.800 0.000
pancreatic cancer 3.000 0.000
dermatomyositis 2.000 0.018
head and neck cancer and chronic obstruc... 1.300 0.008

Gene RIF (90)

PMID Text
26593852 Hydroxylation and O-linked glycosylation sites in col4a1 from human lens capsule.
26406420 High serum Collagen Type IV is associated with ovarian and breast cancer.
26343951 plasma levels increased in second and third trimester pre-eclampsia
26310581 SMAD3 is a necessary factor for TGFbeta-mediated stimulation of mRNA and protein expression of type IV collagen genes in human vascular smooth muscle cells; it regulates expression of COL4a1 and COL4a2
26209635 analysis of the unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide COL4a1/COL4a2 containing a natural interruption site
26178375 The catalytic domain of peroxidasin and its immunoglobulin (Ig) domains are required for efficient sulfilimine bond formation.
26162539 COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM
26006016 Studied the role of alpha1 and alpha2 chains of type IV collagen in UIP; found type IV collagen deposition in early fibrotic lesions of UIP may be implicated in refractory pathophysiology including migration of lesion fibroblasts via a FAK pathway.
25686533 Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts.
25593510 Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity.
More...

AA Sequence

MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEG      1 - 70
PQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGL     71 - 140
PGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGIPGTPGPPGLPGLQGPVGPPGFTGPPGPPGP    141 - 210
PGPPGEKGQMGLSFQGPKGDKGDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEP    211 - 280
GKPGPRGKPGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPG    281 - 350
TPGPRGEPGPKGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPG    351 - 420
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDIDGYRGPPGPQGPPGEIGF    421 - 490
PGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFDLRLKGDKGDPGFPGQPGMTGRAGS    491 - 560
PGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDTGPPGPPGYGPAGPIGDKGQAGFPGGPGSPG    561 - 630
LPGPKGEPGKIVPLPGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGV    631 - 700
DGLPGDMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHG    701 - 770
AIGPPGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPG    771 - 840
PKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPGLPGEKGDHGF    841 - 910
PGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKD    911 - 980
GQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKG    981 - 1050
QAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDK   1051 - 1120
GLPGLDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGE   1121 - 1190
VGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPG   1191 - 1260
IDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGLPGLQGIKGD   1261 - 1330
QGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPKGQQGVTGLVGIPGPPGIPGF   1331 - 1400
DGAPGQKGEMGPAGPTGPRGFPGPPGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHG   1401 - 1470
YSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGEN   1471 - 1540
IRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRS   1541 - 1610
APFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT              1611 - 1669
//

Text Mined References (167)

PMID Year Title
26593852 2016 Comprehensive Characterization of Glycosylation and Hydroxylation of Basement Membrane Collagen IV by High-Resolution Mass Spectrometry.
26406420 2015 Collagen degradation products measured in serum can separate ovarian and breast cancer patients from healthy controls: A preliminary study.
26343951 2015 Anti-angiogenic collagen fragment arresten is increased from 16 weeks' gestation in pre-eclamptic plasma.
26310581 2015 Functional interaction between COL4A1/COL4A2 and SMAD3 risk loci for coronary artery disease.
26209635 2015 NMR studies demonstrate a unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide containing a natural interruption site.
26178375 2015 The Ancient Immunoglobulin Domains of Peroxidasin Are Required to Form Sulfilimine Cross-links in Collagen IV.
26162539 2015 Improved tumour marker sensitivity in detecting colorectal liver metastases by combined type IV collagen and CEA measurement.
26006016 2015 Role of ?1 and ?2 chains of type IV collagen in early fibrotic lesions of idiopathic interstitial pneumonias and migration of lung fibroblasts.
25686533 2015 Dependence of fibroblast infiltration in tumor stroma on type IV collagen-initiated integrin signal through induction of platelet-derived growth factor.
25593510 2015 Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity.
More...