Property Summary

NCBI Gene PubMed Count 69
PubMed Score 8640.27
PubTator Score 3314.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.300 2.8e-17
colon cancer -2.300 2.3e-02
ductal carcinoma in situ 2.100 1.7e-03
invasive ductal carcinoma 2.200 4.5e-03
lung carcinoma 1.200 2.9e-15
non primary Sjogren syndrome sicca 1.100 2.6e-02
ovarian cancer 1.200 5.0e-08
psoriasis -1.300 4.3e-03
ulcerative colitis -1.200 3.8e-03

Gene RIF (46)

AA Sequence

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL      1 - 70
TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR     71 - 140
KDMASNYKELGFQG                                                            141 - 154
//

Text Mined References (69)

PMID Year Title