Property Summary

NCBI Gene PubMed Count 65
Grant Count 398
R01 Count 210
Funding $77,964,502.41
PubMed Score 8413.25
PubTator Score 3314.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 0.004
colon cancer -2.300 0.023
non primary Sjogren syndrome sicca 1.100 0.026
lung carcinoma 1.200 0.000
breast carcinoma 1.300 0.000
ductal carcinoma in situ 2.100 0.002
invasive ductal carcinoma 2.200 0.004
ulcerative colitis -1.200 0.004
ovarian cancer 1.200 0.000

Synonym

Accession P02144 Q52H51 Q5THY7
Symbols PVALB
myoglobgin

Gene

MB

PANTHER Protein Class (1)

PDB

3RGK  

 GO Component (1)

Gene RIF (42)

PMID Text
26894983 In the absence of Mb, the Y-shape structure remains intact. So, a weak electrochemical signal is observed. Upon addition of target, the DApt leave the CS and bind to Mb, leading to disassembly of Y-shape structure and following the addition of Exo I, a strong electrochemical signal could be recorded.
26559958 analysis of myoglobin gene regulatory networks in breast and prostate cancer
26271987 Data show that with the myoglobin (MYO) monoclonal antibody of high specificity and affinity, a one-step sandwich ELISA for detecting MYO has been established successfully, which provides a basis for the development of domestic ELISA kit.
25452214 Data show that chimeric neuroglobin and myoglobin were generated by swapping a regulatory segment.
25172328 Analogous to breast cancer, MB expression in prostate cancer is associated with steroid hormone signaling and markers of hypoxia
25002394 A non-ischemic serum myoglobin release is rare, but could be associated in subgroups of patients.
24446190 Findings indicate that myoglobin (Mb) and neuroglobin (Ngb) can be expressed in nonmuscle and non-neural contexts.
24076247 High myoglobin expression is associated with renal cell carcinoma.
24026678 the novel cancer-associated MB splice variants exhibited increased expression in tumor cells subjected to experimental hypoxia; the novel gene regulatory mechanisms unveiled in this study support the idea of a non-canonical role of MB during carcinogenesis
23931877 Blood myoglobin could serve as a valuable early predictor and marker of rhabdomyolysis and acute myoglobinuric kidney injury
More...

AA Sequence

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL      1 - 70
TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR     71 - 140
KDMASNYKELGFQG                                                            141 - 154
//

Text Mined References (65)

PMID Year Title
26894983 2016 A novel electrochemical aptasensor based on Y-shape structure of dual-aptamer-complementary strand conjugate for ultrasensitive detection of myoglobin.
26559958 2015 The Distinct Gene Regulatory Network of Myoglobin in Prostate and Breast Cancer.
26271987 2015 [Preparation and application of monoclonal antibody against human myoglobin].
25452214 2015 Engineered chimeras reveal the structural basis of hexacoordination in globins: a case study of neuroglobin and myoglobin.
25172328 2014 Myoglobin expression in prostate cancer is correlated to androgen receptor expression and markers of tumor hypoxia.
25002394 2014 Associated factors for non-ischemic serum myoglobin release after cardiac surgical procedures.
24446190 2014 Hematopoietic stem/progenitor cells express myoglobin and neuroglobin: adaptation to hypoxia or prevention from oxidative stress?
24076247 2013 Myoglobin expression in renal cell carcinoma is regulated by hypoxia.
24026678 2014 Extensive transcriptional complexity during hypoxia-regulated expression of the myoglobin gene in cancer.
23931877 2013 Use of myoglobin as a marker and predictor in myoglobinuric acute kidney injury.
More...