Property Summary

NCBI Gene PubMed Count 91
PubMed Score 3230.45
PubTator Score 225.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 3.8e-04

Gene RIF (30)

AA Sequence

MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLT      1 - 70
SFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAI     71 - 140
ALAHKYH                                                                   141 - 147
//

Text Mined References (93)

PMID Year Title