Property Summary

NCBI Gene PubMed Count 123
PubMed Score 515.18
PubTator Score 26.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -2.200 1.8e-02
breast carcinoma -2.500 7.4e-03
dermatomyositis 1.100 4.4e-02
group 3 medulloblastoma -1.100 8.3e-04
invasive ductal carcinoma -1.500 2.9e-02
lung adenocarcinoma -4.200 6.6e-12
lung cancer -1.100 4.1e-04
mucosa-associated lymphoid tissue lympho... 2.436 1.4e-02
non-small cell lung cancer -1.118 4.8e-11
osteosarcoma -7.347 1.9e-05
ovarian cancer -3.100 2.4e-09
pancreatic cancer 1.200 1.3e-03
pancreatic carcinoma 1.200 1.3e-03
tuberculosis 3.300 1.8e-03
Waldenstrons macroglobulinemia 1.773 1.8e-02

Gene RIF (18)

AA Sequence

MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLG      1 - 70
AFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVAN     71 - 140
ALAHKYH                                                                   141 - 147
//

Text Mined References (125)

PMID Year Title