Property Summary

NCBI Gene PubMed Count 29
Grant Count 29
R01 Count 5
Funding $6,678,958.05
PubMed Score 235.37
PubTator Score 52.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Gene RIF (4)

PMID Text
24751163 Data indicate a tetranucleotide 3'UTR motif that is required for the high-level accumulation of zeta-globin transcripts in cultured cells, and demonstrate that it prolongs their cytoplasmic half-lives.
15755797 The HBZ protein is localized to heterochromatin and capable of repressing JUN activity and viral transcription.
15555579 Hb zeta(2)beta(2)(S) exhibits an O(2) affinity as well as a Hill coefficient, Bohr response, and allosteric properties in vitro that are suboptimally suited for physiological O(2) transport in vivo
11747442 Chimeric zeta globin exhibits oxygen binding characteristics which fall within the range observed in adult human and human embryonic hemoglobins.

AA Sequence

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA      1 - 70
VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK     71 - 140
YR                                                                        141 - 142
//

Publication (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24751163 2014 Structural determinants of human ?-globin mRNA stability.
24100324 2013 Structure of fully liganded Hb ?2?2s trapped in a tense conformation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20925047 2010 Haemoglobin level, proportion of haemoglobin Bart's and haemoglobin Portland in fetuses affected by homozygous ?0-thalassemia from 12 to 40 weeks' gestation.
15755797 2005 Nuclear localization of HTLV-I bZIP factor (HBZ) is mediated by three distinct motifs.
15555579 2004 Effect of zeta-globin substitution on the O2-transport properties of Hb S in vitro and in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...