Property Summary

NCBI Gene PubMed Count 29
PubMed Score 251.26
PubTator Score 52.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.1e-04

Gene RIF (4)

AA Sequence

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA      1 - 70
VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK     71 - 140
YR                                                                        141 - 142
//

Text Mined References (34)

PMID Year Title