Property Summary

NCBI Gene PubMed Count 714
Grant Count 45
R01 Count 23
Funding $6,885,586.34
PubMed Score 867.91
PubTator Score 1145.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ulcerative colitis 2.300 0.043
systemic lupus erythematosus -1.800 0.032
glioblastoma 3.100 0.007
Duchenne muscular dystrophy 1.100 0.001
tuberculosis 4.100 0.023
non-small cell lung cancer -1.798 0.000
lung cancer -4.500 0.000
active Crohn's disease 4.148 0.008
adult high grade glioma 2.300 0.010
primary Sjogren syndrome 3.300 0.000
lung carcinoma -2.600 0.000
invasive ductal carcinoma 4.000 0.014
ovarian cancer 1.100 0.045
type I diabetes mellitus -4.048 0.025
Chronic obstructive pulmonary disease -1.800 0.022

Gene

PDB

1UVQ   1JK8   4GG6   4OZF   4OZG   4OZH   4OZI   1NBN   1S9V   2NNA   5KSA   5KSB  

Gene RIF (732)

PMID Text
26829749 We found association of three variants in the region harboring genes encoding the class II human leukocyte antigens (HLAs): both located between HLA-DQA1 and HLA-DRB1
26829741 HLA-DQA1 alleles contribute to the susceptibility of unexplained recurrent spontaneous abortion among ethnic Han Chinese.
26818121 HLA-DQA1*0102 and HLA-DQB1*0201 alleles may be involved in the production of anti-beta2-glycoprotein I antibody in recurrent miscarriage patients.
26671138 DQA1*0501 had significant negative association with MuSK myasthenia gravis.
26524976 Suggest that the DQA1*0103/CD74 dimer may result in presentation of unique antigens and susceptibility to develop arthritis.
26498496 The observed positive association between integrated HIV-1 DNA load and frequency of CD8(+)DR/DP/DQ(+) cells indicates that a close correlation between HIV persistence and immune activation continues during consistently suppressive therapy.
26362370 Pharmacoresistant temporal lobe epilepsy associated with mesial hippocampal sclerosis is not determined by HLA class II alleles in the DRB1, DQB1, and DQA1 regions but the HLA DRB1*1302 allele exhibited a tendency to behave as a susceptibility factor
26168013 Data indicate interactions for 11 of 21 pairs of common HLA-DRB1-HLA-DQA1-HLA-DQB1 haplotypes.
26095634 The protective effects against type 1 diabetes mellitus of HLA-DQA1*01:01, HLA-DQB1*05:03, *06:02, *06:03, and *06:04 were robustly suggested by all indicators of meta-analyses. (Meta-analysis)
26007157 No significant association with tuberculosis risk was found in any HLA-DQA1 allele.
More...

AA Sequence

MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWC      1 - 70
LPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPP     71 - 140
VVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAP    141 - 210
MSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL                              211 - 254
//

Text Mined References (723)

PMID Year Title
26829749 2016 HLA class II sequence variants influence tuberculosis risk in populations of European ancestry.
26829741 2016 [Analysis of the association of human leukocyte antigen DQ gene polymorphisms with unexplained recurrent spontaneous abortion among ethnic Han Chinese from Wenzhou region].
26818121 2016 Association of HLA-DQ alleles with the presence of an anti-?2-glycoprotein I antibody in patients with recurrent miscarriage.
26671138 2015 Association of HLA class II (DRB1, DQA1, DQB1) alleles and haplotypes with myasthenia gravis and its subgroups in the Iranian population.
26524976 2016 CD74/DQA1 dimers predispose to the development of arthritis in humanized mice.
26498496 2015 During Stably Suppressive Antiretroviral Therapy Integrated HIV-1 DNA Load in Peripheral Blood is Associated with the Frequency of CD8 Cells Expressing HLA-DR/DP/DQ.
26362370 2015 Genetic association study of the HLA class II alleles DRB1, DQA1, and DQB1 in patients with pharmacoresistant temporal lobe epilepsy associated with mesial hippocampal sclerosis.
26168013 2015 Additive and interaction effects at three amino acid positions in HLA-DQ and HLA-DR molecules drive type 1 diabetes risk.
26095634 2015 Association of HLA-DQA1 and -DQB1 alleles with type I diabetes in Arabs: a meta-analyses.
26007157 2015 The Relationship of HLA-DQ Alleles with Tuberculosis Risk: A Meta-analysis.
More...