Property Summary

NCBI Gene PubMed Count 52
PubMed Score 184.15
PubTator Score 37.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 169 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1156
Disease Target Count P-value
lung carcinoma 2755 1.6e-25
breast carcinoma 1589 9.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.900 9.8e-04
lung carcinoma -3.000 1.6e-25

 CSPA Cell Line (1)

Gene RIF (51)

AA Sequence

MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQ      1 - 70
LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFP     71 - 140
PVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPA    141 - 210
PMSELTETLVCALGLSVGLMGIVVGTVFIIQGLRSVGASRHQGLL                             211 - 255
//

Text Mined References (59)

PMID Year Title