Property Summary

NCBI Gene PubMed Count 194
Grant Count 20
R01 Count 14
Funding $1,813,083.36
PubMed Score 125.11
PubTator Score 126.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (159)

PMID Text
25998395 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25792471 The frequency of CD14(+)HLA-DR-/low MDSCs could be considered as a poor prognostic predictor in small-cell lung cancer (SCLC) and the elimination of MDSCs during medical interventions may improve the prognosis of SCLC patients.
25720714 No significant association was found for HLA-DRA/PARK18 rs3129882 polymorphism and Parkinson's disease risk (meta-analysis).
25695487 CD14+HLA-DR(-/low) cells were significantly increased in gastric cancer tissue and were shown to have a critical role in CD4+T-cell immunosuppression.
25319953 The results suggest that rs3129882 polymorphism in HLA-DR may be a risk factor for Parkinson's disease in Iranian.
25240755 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25224099 HLA-DRA variants predict penicillin allergy in genome-wide fine-mapping genotyping
25057007 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24904546 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24849299 This meta-analysis showed that the HLA-DRA rs3129882 A/G polymorphism was not a risk factor for Parkinson's disease in Chinese.
More...

AA Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRL      1 - 70
EEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPP     71 - 140
VVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSP    141 - 210
LPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL                              211 - 254
//

Text Mined References (71)

PMID Year Title
17241953 2007 Autophagy in MHC class II presentation: sampling from within.
16341674 2005 Transcriptome analysis of human gastric cancer.
16079912 2005 Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
15836703 2005 Association of fulminant non-A non-B hepatitis with homozygosity for HLA A1-B8-DR3.
15688398 2005 Tumor HLA-DR expression linked to early intrahepatic recurrence of hepatocellular carcinoma.
15536412 2004 Genetic basis of the latex-fruit syndrome: association with HLA class II alleles in a Spanish population.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467430 2004 Anomalous expression of the HLA-DR alpha and beta chains in ovarian and other cancers.
15361126 2004 Microgeographic variation of HLA-A, -B, and -DR haplotype frequencies in Tuscany, Italy: implications for recruitment of bone marrow donors.
More...