Property Summary

NCBI Gene PubMed Count 198
PubMed Score 129.56
PubTator Score 126.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.0
Parkinson Disease 64 0.0 0.0
Shock, Septic 6 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ischemic fasciitis 1 3.678 1.8

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 5.787 5.9e-06
active ulcerative colitis 5.097 1.5e-04
adrenocortical carcinoma -1.549 3.3e-02
adult high grade glioma 2.300 1.7e-03
astrocytoma 1.200 7.3e-05
Astrocytoma, Pilocytic 3.200 5.1e-10
Becker muscular dystrophy 1.498 5.9e-04
Breast cancer 1.600 3.5e-02
breast carcinoma 2.000 1.7e-03
diabetes mellitus -1.100 4.7e-03
Down syndrome 1.900 1.6e-03
Duchenne muscular dystrophy 2.347 6.8e-11
ependymoma 2.300 4.7e-08
esophageal adenocarcinoma 1.200 1.8e-02
glioblastoma 1.900 4.3e-04
head and neck cancer and chronic obstruc... 1.100 1.1e-02
interstitial cystitis 1.600 3.8e-04
intraductal papillary-mucinous carcinoma... -2.200 4.0e-02
invasive ductal carcinoma 1.434 2.4e-04
juvenile dermatomyositis 1.128 4.9e-04
limb girdle muscular dystrophy 2A 1.615 2.2e-06
lung cancer -2.600 1.8e-05
lung carcinoma -2.700 3.4e-42
non-small cell lung cancer -1.219 7.2e-08
ovarian cancer -1.400 1.8e-02
primary pancreatic ductal adenocarcinoma 1.125 3.2e-03
primary Sjogren syndrome 3.300 1.0e-04
subependymal giant cell astrocytoma 2.656 4.9e-02
Waldenstrons macroglobulinemia 1.516 3.6e-02

PDB (82)

Gene RIF (157)

AA Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRL      1 - 70
EEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPP     71 - 140
VVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSP    141 - 210
LPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL                              211 - 254
//

Text Mined References (215)

PMID Year Title