Property Summary

NCBI Gene PubMed Count 198
PubMed Score 129.56
PubTator Score 126.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.0
Parkinson Disease 64 0.0 0.0
Shock, Septic 6 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ischemic fasciitis 1 3.678 1.8

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 5.787 5.9e-06
active ulcerative colitis 5.097 1.5e-04
adrenocortical carcinoma -1.549 3.3e-02
adult high grade glioma 2.300 1.7e-03
astrocytoma 1.200 7.3e-05
Astrocytoma, Pilocytic 3.200 5.1e-10
Becker muscular dystrophy 1.498 5.9e-04
Breast cancer 1.600 3.5e-02
breast carcinoma 2.000 1.7e-03
diabetes mellitus -1.100 4.7e-03
Down syndrome 1.900 1.6e-03
Duchenne muscular dystrophy 2.347 6.8e-11
ependymoma 2.300 4.7e-08
esophageal adenocarcinoma 1.200 1.8e-02
glioblastoma 1.900 4.3e-04
head and neck cancer and chronic obstruc... 1.100 1.1e-02
interstitial cystitis 1.600 3.8e-04
intraductal papillary-mucinous carcinoma... -2.200 4.0e-02
invasive ductal carcinoma 1.434 2.4e-04
juvenile dermatomyositis 1.128 4.9e-04
limb girdle muscular dystrophy 2A 1.615 2.2e-06
lung cancer -2.600 1.8e-05
lung carcinoma -2.700 3.4e-42
non-small cell lung cancer -1.219 7.2e-08
ovarian cancer -1.400 1.8e-02
primary pancreatic ductal adenocarcinoma 1.125 3.2e-03
primary Sjogren syndrome 3.300 1.0e-04
subependymal giant cell astrocytoma 2.656 4.9e-02
Waldenstrons macroglobulinemia 1.516 3.6e-02

Synonym

Accession P01903 A2BET4 Q30160 Q6IAZ1 Q861I2 Q9TP70
Symbols HLA-DRA1

Gene

PDB

2FSE   2SEB   4IS6   1BX2   1FV1   1HQR   1YMM   1ZGL   6ATZ   4Y19   4Y1A   1AQD   4OV5   3O6F   3T0E   4C56   1FYT   1J8H   2IAM   2IAN   2XN9   1A6A   2WBJ   1D5M   1D5X   1D5Z   1D6E   1DLH   1H15   1HXY   1JWM   1JWS   1JWU   1KG0   1KLG   1KLU   1LO5   1PYW   1R5I   1SEB   1SJE   1SJH   1T5W   1T5X   2G9H   2ICW   2IPK   2OJE   2Q6W   3C5J   3L6F   3PDO   3PGC   3PGD   3QXA   3QXD   3S4S   3S5L   4AEN   4AH2   4E41   4FQX   4GBX   4H1L   4H25   4H26   4I5B   4MCY   4MCZ   4MD0   4MD4   4MD5   4MDI   4MDJ   4X5W   4X5X   5JLZ   5LAX   5V4M   5V4N   6ATF   6ATI  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (157)

AA Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRL      1 - 70
EEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPP     71 - 140
VVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSP    141 - 210
LPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL                              211 - 254
//

Text Mined References (215)

PMID Year Title