Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Synonym

Accession P01893
Symbols HLAHP

Gene

Gene RIF (3)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
15359910 Observational study of gene-disease association. (HuGE Navigator)
15350465 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVLMAPRTLLLLLSGALALTQTWARSHSMRYFYTTMSRPGAGEPRFISVGYVDDTQFVRFDSDDASPREE      1 - 70
PRAPWMEREGPKYWDRNTQICKAQAQTERENLRIALRYYNQSEGGSHTMQVMYGCDVGPDGPFLRGYEQH     71 - 140
AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAARRAEQRRVYLEGEFVEWLRRYLENGKETLQRADPPK    141 - 210
THMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWEPSSQPTVPIVGIVAGLVLLVAVVTGAVVAAVMWRKKSSDRKGGSYSQAASS    281 - 350
NSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (11)

PMID Year Title
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15359910 2004 [Role of polymorphic adhesion molecules in the development of graft-versus-leukemia effect after HLA-matched allogeneic stem cell transplantation].
15350465 Minor histocompatibility antigen HA-1 and HPA-5 polymorphisms in HLA-identical related bone marrow transplantation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9866194 1998 HLA-H: a pseudogene with increased variation due to balancing selection at neighboring loci.
9162021 1997 The hemochromatosis founder mutation in HLA-H disrupts beta2-microglobulin interaction and cell surface expression.
6461010 1982 Exon/intron organization and complete nucleotide sequence of an HLA gene.
2329283 1990 HLA-AR, an inactivated antigen-presenting locus related to HLA-A. Implications for the evolution of the MHC.
2294403 1990 Transcription analysis, physical mapping, and molecular characterization of a nonclassical human leukocyte antigen class I gene.
More...