Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MVLMAPRTLLLLLSGALALTQTWARSHSMRYFYTTMSRPGAGEPRFISVGYVDDTQFVRFDSDDASPREE      1 - 70
PRAPWMEREGPKYWDRNTQICKAQAQTERENLRIALRYYNQSEGGSHTMQVMYGCDVGPDGPFLRGYEQH     71 - 140
AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAARRAEQRRVYLEGEFVEWLRRYLENGKETLQRADPPK    141 - 210
THMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWEPSSQPTVPIVGIVAGLVLLVAVVTGAVVAAVMWRKKSSDRKGGSYSQAASS    281 - 350
NSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (11)

PMID Year Title