Property Summary

NCBI Gene PubMed Count 1,767
PubMed Score 1613.47
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Ankylosing spondylitis 140
Arthritis 290
Abdominal Pain 98
Abnormal blistering of the skin 54
Abnormal respiratory patterns 20
Abnormality of aortic valve 9
Acantholysis 6
Acne 52
Adverse reaction to drug 61
Anemia 365
Aneurysm 7
Aneurysmal disease 6
Anorexia 43
Aphthous stomatitis 16
Arthralgia 90
Ascending aorta dilatation 5
Blister of skin 54
Chest Pain 38
Confusion 21
Deglutition Disorders 132
Diarrhea 253
Drooling 27
Drug allergy 36
Epilepsy 792
Erythema 58
Fatigue 182
Fever 138
Flushing 60
Gait abnormality 135
Gangrene 4
Gastrointestinal Hemorrhage 52
Hemiparesis 34
Hemoglobin low 124
Hyperhidrosis disorder 81
Hypertensive crisis 4
Hypertrophic Cardiomyopathy 117
Idiopathic pulmonary arterial hypertension 40
Immunologic Hypersensitivity 10
Increased sweating 81
Inflammatory abnormality of the eye 10
Intermittent migraine headaches 68
Macule 19
Meningitis 67
Migraine Disorders 76
Multiple, subcutaneous nodules 53
Muscle Weakness 170
Myalgia 54
Myocardial Infarction 151
Nausea and vomiting 97
Neutrophil abnormality 20
Nikolsky sign 6
Oral Ulcer 15
Orchitis 28
Papule 43
Photodysphoria 121
Photophobia 121
Psychotic Disorders 151
Pulmonary arterial hypertension associated with connective tissue disease 1
Pulmonary hypertension 85
Recurrent aphthous ulcer 14
Schizophrenia 1160
Seizures 596
Sialorrhea 28
Skin Ulcer 48
Skin bulla 54
Subcutaneous nodule 53
Sweating 81
Takayasu Arteritis 4
Vasculitis 80
Venous Thrombosis 47
Weight decreased 103
pulmonary arterial hypertension 75
Disease Target Count P-value
lung carcinoma 2843 4.7e-20

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 4.7e-20

Gene RIF (1722)

AA Sequence

MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE      1 - 70
PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQY     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1772)

PMID Year Title