Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 3.78

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.17226887268097E-12
psoriasis 6685 4.01286404620028E-6
Multiple myeloma 1328 8.02280323562595E-6
lung cancer 4473 6.36941744461625E-5
nasopharyngeal carcinoma 1056 0.00136956569172482
tuberculosis and treatment for 3 months 327 0.00223254674350623
pancreatic carcinoma 567 0.0174370751297172
pancreatic cancer 2300 0.0174370751297173
chronic lymphosyte leukemia 232 0.0207958181310678
gastric cancer 436 0.023707990185185
ulcerative colitis 2087 0.0310569782679174


  Differential Expression (11)

Disease log2 FC p
gastric cancer -1.400 0.024
pancreatic cancer -1.500 0.017
Multiple myeloma -5.212 0.000
osteosarcoma -7.297 0.000
chronic lymphosyte leukemia -1.300 0.021
tuberculosis and treatment for 3 months 1.500 0.002
lung cancer -3.500 0.000
pancreatic carcinoma -1.500 0.017
nasopharyngeal carcinoma -1.800 0.001
ulcerative colitis 1.200 0.031
psoriasis -1.600 0.000

Gene RIF (7)

17475860 IgD heavy chain constant region CH1 is involved in the interaction with Haemophilus influenzae serotype b, and amino acids 198-206 of IgD CH1 likely play a key role in this interaction.
17169423 IGHD gene mutations are associated with chronic lymphocytic leukemia
16402215 surprising lack of diversity in the available IGHD gene repertoire
12023968 role of constant region carbohydrate in the assembly and secretion of human IgD.
11902141 Role of surface IgM and IgD on survival/apoptosis of B-cell chronic lymphocytic leukemia cells.
8418208 Gene inactivation in mice shows that IgD is an auxiliary antigen receptor
1838007 Mouse B cells can develop and function without expressing IgD due to targeted gene inactivation

AA Sequence

ATYTCVVSHEDSRTLLNASRSLEVSYVTDHGPMK                                        351 - 384

Text Mined References (25)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17475860 2007 Characterization of the IgD binding site of encapsulated Haemophilus influenzae serotype b.
17169423 2007 Use of IGHJ and IGHD gene mutations in analysis of immunoglobulin sequences for the prognosis of chronic lymphocytic leukemia.
16895553 2006 The riddle of the dual expression of IgM and IgD.
16402215 2006 Reconsidering the human immunoglobulin heavy-chain locus: 1. An evaluation of the expressed human IGHD gene repertoire.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.