Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 3.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
chronic lymphosyte leukemia -1.300 2.1e-02
gastric cancer -1.400 2.4e-02
lung cancer -1.300 1.0e-02
Multiple myeloma -5.212 8.0e-06
nasopharyngeal carcinoma -1.800 1.4e-03
osteosarcoma -7.297 1.2e-12
pancreatic cancer -1.500 1.7e-02
pancreatic carcinoma -1.500 1.7e-02
psoriasis -1.600 4.0e-06
tuberculosis 1.200 2.0e-02
ulcerative colitis 1.200 3.1e-02

Gene RIF (8)

AA Sequence

APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQL      1 - 70
STPLQQWRQGEYKCVVQHTASKSKKEIFRWPESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGE     71 - 140
EKKKEKEKEEQEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKDAHLTWEVAGKV    141 - 210
PTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLNLL    211 - 280
ASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPRSTTFWAWSVLRVPAPPSPQP    281 - 350
ATYTCVVSHEDSRTLLNASRSLEVSYVTDHGPMK                                        351 - 384
//

Text Mined References (31)

PMID Year Title