Property Summary

NCBI Gene PubMed Count 46
PubMed Score 0.00
PubTator Score 14.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 4.5e-06
psoriasis 6694 5.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -2.300 4.5e-06
psoriasis -1.100 5.7e-04

Gene RIF (21)

AA Sequence

ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQL      1 - 70
TLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLG     71 - 140
SEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPE    141 - 210
SKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWA    211 - 280
SRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG    281 - 350
TCY                                                                       351 - 353
//

Text Mined References (57)

PMID Year Title