Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.00
PubTator Score 14.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non-inflammatory breast cancer -2.900 0.009
psoriasis -1.100 0.001

Synonym

Accession P01876
Symbols IgA1

Gene

PDB

1OW0   1IGA   2QEJ   3CHN  

Gene RIF (20)

PMID Text
26986150 In IgA nephropathy, increased APRIL is accompanied by elevated expression of its receptors in B-lymphocytes, which induces overproduction of galactose-deficient-IgA1.
26596049 The lower content of secretory immunoglobulin A and interferon-gamma plus increased level of interleukin l-beta in saliva of patients with caries of contact surfaces of lateral teeth can be considered as factor predisposing to development of caries.
25694468 Complement activation plays a key role in the pathogenesis and IGAN expression in patients diagnosed with IGA nephropathy.
25647400 hypermethylation of Cosmc promoter region could be a key mechanism for the reduction of Cosmc mRNA expression in IgAN lymphocytes with associated increase in aberrantly glycosylated IgA1
24928472 Serum under-O-glycosylated IgA1 levels are not correlated with glomerular IgA deposition based upon heterogeneity in the composition of glomerular immune complexes in IgAN patients.
24918438 The study developed a new model for sugar-specific sialylation of IgA1 O-glycans and showed that GalNAc recognition by Helix aspersa lectin is modulated by sialylation of not only GalNAc but also of Gal in the clustered IgA1 O-glycans.
24676358 The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus.
24586974 The palatine tonsils are probably a major site of galactose-deficient IgA1-producing cells.
22864623 In breast cancer, elevated levels of antibodies recognizing aberrant MUC1 are associated with better outcome, whereas in IgA nephropathy, the antibodies recognizing aberrant IgA1 are part of the pathogenetic process. [review]
20007591 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQL      1 - 70
TLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLG     71 - 140
SEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPE    141 - 210
SKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWA    211 - 280
SRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDG    281 - 350
TCY                                                                       351 - 353
//

Text Mined References (50)

PMID Year Title
26986150 2016 Increased APRIL Expression Induces IgA1 Aberrant Glycosylation in IgA Nephropathy.
26596049 2015 [THE IMMUNOLOGIC INDICATORS IN PATIENTS WITH CARIES OF CONTACT SURFACES OF LATERAL TEETH].
25694468 2015 Current Understanding of the Role of Complement in IgA Nephropathy.
25647400 2015 DNA methylation in Cosmc promoter region and aberrantly glycosylated IgA1 associated with pediatric IgA nephropathy.
24928472 2014 Serum under-O-glycosylated IgA1 level is not correlated with glomerular IgA deposition based upon heterogeneity in the composition of immune complexes in IgA nephropathy.
24918438 2014 Enzymatic sialylation of IgA1 O-glycans: implications for studies of IgA nephropathy.
24676358 2014 IgA measurements in over 12 000 Swedish twins reveal sex differential heritability and regulatory locus near CD30L.
24586974 2014 Changes in nephritogenic serum galactose-deficient IgA1 in IgA nephropathy following tonsillectomy and steroid therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
More...