Property Summary

NCBI Gene PubMed Count 31
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P01871 P20769
Symbols MU
VH
AGM1

Gene

PDB

2AGJ  

Gene RIF (6)

PMID Text
24141767 Rearrangement of the immunoglobulin mu-chain gene is associated with acute myeloid leukemia.
22305633 Serum immunoglobulin M anti-phosphorylcholine titers provide prognostic information for risk factors in acute coronary syndrome.
18515657 tracked the clonal history of tumor cells by studying mutations on the switch mu region of the der(14)t(14;18) during the early phase of the class-switch recombination
18174230 Observational study of gene-disease association. (HuGE Navigator)
15591116 lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains.
11839670 Intraclonal homogeneity of clonotypic immunoglobulin M and diversity of nonclinical post-switch isotypes in multiple myeloma: insights into the evolution of the myeloma clone

AA Sequence

GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITLSWKYKNNSDISSTRGFPSVLRGGKYAATSQ      1 - 70
VLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFS     71 - 140
PRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNA    141 - 210
SSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNA    211 - 280
TFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATIT    281 - 350
CLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVAHEALP    351 - 420
NRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY                                          421 - 452
//

Text Mined References (38)

PMID Year Title
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24963139 2014 B cell activation involves nanoscale receptor reorganizations and inside-out signaling by Syk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
24141767 2014 Rearrangement and expression of the immunoglobulin ?-chain gene in human myeloid cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22427638 2012 Vigorous response of human innate functioning IgM memory B cells upon infection by Neisseria gonorrhoeae.
More...