Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPP     71 - 140
CPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVD    141 - 210
GVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYT    211 - 280
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG    281 - 350
NIFSCSVMHEALHNRFTQKSLSLSPGK                                               351 - 377
//

Text Mined References (28)

PMID Year Title