Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Synonym

Accession P01860 A2NU35
Symbols IgG3

Gene

PDB

4WWI   4ZNC  

Gene RIF (4)

PMID Text
26232328 This study provides insights into the effector functions of human IgG3 in the context of an antibody targeting TfR1.
24619312 Logistic regression indicated that IgG3 detection was the only variable significantly related to the occurrence of RBC transfusion in autoimmune haemolytic anaemias
19542624 Immunoglobulin (Ig) GM genes - genetic markers of IgG heavy chains located on chromosome 14 - are functional risk and protective factors for AD.
17933503 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPP     71 - 140
CPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVD    141 - 210
GVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYT    211 - 280
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQG    281 - 350
NIFSCSVMHEALHNRFTQKSLSLSPGK                                               351 - 377
//

Text Mined References (24)

PMID Year Title
26232328 2015 Insights into the effector functions of human IgG3 in the context of an antibody targeting transferrin receptor 1.
24619312 2014 Haemoglobin levels in autoimmune haemolytic anaemias at diagnosis: relationship with immunoproteins on red blood cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23225573 2013 Genetic variants in the immunoglobulin heavy chain locus are associated with the IgG index in multiple sclerosis.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
19542624 2009 Immunoglobulin GM genes as functional risk and protective factors for the development of Alzheimer's disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...