Property Summary

NCBI Gene PubMed Count 28
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myositis 30 0.0 0.0
Disease Target Count
Kappa-Chain Deficiency 2
Disease Target Count P-value
psoriasis 6694 2.6e-07

Expression

Gene RIF (5)

AA Sequence

ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTC     71 - 140
VVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAP    141 - 210
IEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSD    211 - 280
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK                            281 - 326
//

Text Mined References (35)

PMID Year Title