Property Summary

NCBI Gene PubMed Count 28
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

Gene RIF (5)

PMID Text
25842870 stability of IgG2 C(H2 domains in the "physiological" range of temperatures (20-37 degrees C), mainly, with entropy factor
18974198 The effect of Fc glycan forms on human IgG2 antibody clearance in humans is reported.
18821675 Observational study of gene-disease association. (HuGE Navigator)
16944158 genotypes at Immunoglobulin G2M (G2M n+,n-) loci are significantly associated with Systemic Lupus Erthematosus
16785571 Homozygosity for the G2M*n allele is strongly associated with absence of severe infections in Swedish patients with hereditary complement 2-deficiency and suggests a major protective role.

AA Sequence

ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT      1 - 70
VPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTC     71 - 140
VVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAP    141 - 210
IEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSD    211 - 280
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK                            281 - 326
//

Text Mined References (31)

PMID Year Title
25842870 [[correlation between macro- and micro-stability C(H)2 domains of human IgG2 and their biological activity. II. Calculation of thermodynamic functions characterizing domains stability].
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23225573 2013 Genetic variants in the immunoglobulin heavy chain locus are associated with the IgG index in multiple sclerosis.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18974198 2009 The effect of Fc glycan forms on human IgG2 antibody clearance in humans.
More...